Aurora Kinase C anticorps (Middle Region)

N° du produit ABIN631252

Détail du produit anti-Aurora Kinase C anticorps

Antigène: Aurora Kinase C (AURKC)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Aurora Kinase C est non-conjugé

Application: Western Blotting (WB)

Specificité: AURKC antibody was raised against the middle region of AURKC

Purification: Affinity purified

Immunogène: AURKC antibody was raised using the middle region of AURKC corresponding to a region with amino acids TYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AURKC Blocking Peptide, catalog no. 33R-9386, is also available for use as a blocking control in assays to test for specificity of this AURKC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AURKC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Aurora Kinase C

Antigène: Aurora Kinase C (AURKC)

Autre désignation: AURKC (AURKC Produits)

Synonymes: anticorps AURKC, anticorps AIE2, anticorps AIK3, anticorps ARK3, anticorps AurC, anticorps SPGF5, anticorps STK13, anticorps aurora-C, anticorps AIE1, anticorps ARK-3, anticorps IAK3, anticorps Stk13, anticorps aurora kinase C, anticorps AURKC, anticorps Aurkc

Sujet: AURKC may play a part in organizing microtubules in relation to the function of the centrosome/spindle pole during mitosis.

Poids moléculaire: 34 kDa (MW of target protein)

Pathways: Cycle Cellulaire, Maintenance of Protein Location