AHCY anticorps (N-Term)

N° du produit ABIN631294

Cet anticorps Lapin Polyclonal détecte spécifiquement AHCY dans WB. Il présente une réactivité avec des échantillons de Humain et Souris.

Aperçu rapide pour AHCY anticorps (N-Term) (ABIN631294)

Antigène: AHCY (Adenosylhomocysteinase (AHCY))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AHCY est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-AHCY anticorps

Épitope: N-Term

Specificité: AHCY antibody was raised against the N terminal of AHCY

Purification: Affinity purified

Immunogène: AHCY antibody was raised using the N terminal of AHCY corresponding to a region with amino acids SDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AHCY Blocking Peptide, (ABIN5611977), is also available for use as a blocking control in assays to test for specificity of this AHCY antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AHCY antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AHCY

Antigène: AHCY (Adenosylhomocysteinase (AHCY))

Autre désignation: AHCY

Sujet: S-adenosylhomocysteine hydrolase catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). Thus, it regulates the intracellular S-adenosylhomocysteine (SAH) concentration thought to be important for transmethylation reactions. Deficiency in this protein is one of the different causes of hypermethioninemia.

Poids moléculaire: 48 kDa (MW of target protein)