AHCY anticorps (N-Term)

N° du produit ABIN631294

Détail du produit anti-AHCY anticorps

Antigène: AHCY (Adenosylhomocysteinase (AHCY))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AHCY est non-conjugé

Application: Western Blotting (WB)

Specificité: AHCY antibody was raised against the N terminal of AHCY

Purification: Affinity purified

Immunogène: AHCY antibody was raised using the N terminal of AHCY corresponding to a region with amino acids SDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AHCY Blocking Peptide, catalog no. 33R-8359, is also available for use as a blocking control in assays to test for specificity of this AHCY antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AHCY antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AHCY

Antigène: AHCY (Adenosylhomocysteinase (AHCY))

Autre désignation: AHCY (AHCY Produits)

Synonymes: anticorps sahh, anticorps PSPTO5068, anticorps Ahcy, anticorps SAHH, anticorps adoHcyase, anticorps ahcy, anticorps AA987153, anticorps AL024110, anticorps CuBP, anticorps D150, anticorps cb1079, anticorps hm:zeh1173, anticorps hm:zeh1364, anticorps wu:fj67b02, anticorps adenosylhomocysteinase, anticorps Adenosylhomocysteinase, anticorps S-adenosylhomocysteine hydrolase, anticorps adenosylhomocysteinase S homeolog, anticorps AHCY, anticorps ahcy, anticorps ahcY, anticorps MMAH_RS02605, anticorps Srot_2217, anticorps Ndas_3755, anticorps Deba_0936, anticorps Palpr_2392, anticorps Calni_0569, anticorps LOC100282150, anticorps Intca_2510, anticorps Marky_0392, anticorps Desac_1394, anticorps Tc00.1047053511229.50, anticorps Tc00.1047053511589.200, anticorps Tb11.01.1350, anticorps LMJF_36_3910, anticorps MCYG_06244, anticorps Ahcy, anticorps ahcy.S

Sujet: S-adenosylhomocysteine hydrolase catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). Thus, it regulates the intracellular S-adenosylhomocysteine (SAH) concentration thought to be important for transmethylation reactions. Deficiency in this protein is one of the different causes of hypermethioninemia.

Poids moléculaire: 48 kDa (MW of target protein)