AHCY anticorps (N-Term)
-
- Antigène Voir toutes AHCY Anticorps
- AHCY (Adenosylhomocysteinase (AHCY))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AHCY est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- AHCY antibody was raised against the N terminal of AHCY
- Purification
- Affinity purified
- Immunogène
- AHCY antibody was raised using the N terminal of AHCY corresponding to a region with amino acids SDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIA
- Top Product
- Discover our top product AHCY Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
AHCY Blocking Peptide, catalog no. 33R-8359, is also available for use as a blocking control in assays to test for specificity of this AHCY antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AHCY antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- AHCY (Adenosylhomocysteinase (AHCY))
- Autre désignation
- AHCY (AHCY Produits)
- Synonymes
- anticorps sahh, anticorps PSPTO5068, anticorps Ahcy, anticorps SAHH, anticorps adoHcyase, anticorps ahcy, anticorps AA987153, anticorps AL024110, anticorps CuBP, anticorps D150, anticorps cb1079, anticorps hm:zeh1173, anticorps hm:zeh1364, anticorps wu:fj67b02, anticorps adenosylhomocysteinase, anticorps Adenosylhomocysteinase, anticorps S-adenosylhomocysteine hydrolase, anticorps adenosylhomocysteinase S homeolog, anticorps AHCY, anticorps ahcy, anticorps ahcY, anticorps MMAH_RS02605, anticorps Srot_2217, anticorps Ndas_3755, anticorps Deba_0936, anticorps Palpr_2392, anticorps Calni_0569, anticorps LOC100282150, anticorps Intca_2510, anticorps Marky_0392, anticorps Desac_1394, anticorps Tc00.1047053511229.50, anticorps Tc00.1047053511589.200, anticorps Tb11.01.1350, anticorps LMJF_36_3910, anticorps MCYG_06244, anticorps Ahcy, anticorps ahcy.S
- Sujet
- S-adenosylhomocysteine hydrolase catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). Thus, it regulates the intracellular S-adenosylhomocysteine (SAH) concentration thought to be important for transmethylation reactions. Deficiency in this protein is one of the different causes of hypermethioninemia.
- Poids moléculaire
- 48 kDa (MW of target protein)
-