Myosin 9 anticorps (Middle Region)

N° du produit ABIN631312

Détail du produit anti-Myosin 9 anticorps

Antigène: Myosin 9 (MYH9)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Myosin 9 est non-conjugé

Application: Western Blotting (WB)

Specificité: MYH9 antibody was raised against the middle region of MYH9

Purification: Affinity purified

Immunogène: MYH9 antibody was raised using the middle region of MYH9 corresponding to a region with amino acids DAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MYH9 Blocking Peptide, catalog no. 33R-1860, is also available for use as a blocking control in assays to test for specificity of this MYH9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYH9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Myosin 9

Antigène: Myosin 9 (MYH9)

Autre désignation: MYH9 (MYH9 Produits)

Synonymes: anticorps BDPLT6, anticorps DFNA17, anticorps EPSTS, anticorps FTNS, anticorps MHA, anticorps NMHC-II-A, anticorps NMMHC-IIA, anticorps NMMHCA, anticorps C80049, anticorps D0Jmb2, anticorps E030044M24Rik, anticorps Fltn, anticorps Myhn-1, anticorps Myhn1, anticorps NMHC II-A, anticorps NMHCIIA, anticorps NMMHC II-a, anticorps NMMHC-A, anticorps TU72.6, anticorps fi22c04, anticorps myh9, anticorps myh9l2, anticorps wu:fi22c04, anticorps wu:fj85e11, anticorps zgc:162029, anticorps zgc:66164, anticorps NMMHC, anticorps myosin, anticorps non-muscle, anticorps nonmuscle, anticorps KLG/PTK7, anticorps dfna17, anticorps epsts, anticorps ftns, anticorps nmhc-ii-a, anticorps nmmhca, anticorps myosin heavy chain 9, anticorps myosin, heavy polypeptide 9, non-muscle, anticorps myosin, heavy chain 9a, non-muscle, anticorps myosin, heavy chain 9, non-muscle, anticorps myosin, heavy chain 9, non-muscle L homeolog, anticorps MYH9, anticorps Myh9, anticorps myh9a, anticorps myh9.L

Sujet: MYH9 is a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain. The protein is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in MYH9 are the cause of non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness.

Poids moléculaire: 226 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling, Integrin Complex