LSS anticorps

N° du produit ABIN631321

Détail du produit anti-LSS anticorps

Antigène: LSS (Lanosterol Synthase (2,3-Oxidosqualene-Lanosterol Cyclase) (LSS))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LSS est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: LSS antibody was raised using a synthetic peptide corresponding to a region with amino acids TEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LSS Blocking Peptide, catalog no. 33R-9038, is also available for use as a blocking control in assays to test for specificity of this LSS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LSS

Antigène: LSS (Lanosterol Synthase (2,3-Oxidosqualene-Lanosterol Cyclase) (LSS))

Autre désignation: LSS (LSS Produits)

Synonymes: anticorps OSC, anticorps 2810025N20Rik, anticorps BC029082, anticorps D10Ertd116e, anticorps Osc, anticorps xlss, anticorps Tb07.27E10.490, anticorps NCU01119.1, anticorps lanosterol synthase, anticorps lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase), anticorps putative lanosterol synthase, anticorps Lanosterol synthase, putative, anticorps LSS, anticorps Lss, anticorps lss, anticorps CND02520, anticorps Tc00.1047053506825.170, anticorps Tc00.1047053508175.70, anticorps Tb927.7.5230, anticorps NCU01119, anticorps LMJF_06_0650, anticorps CGB_D5080W, anticorps LOC100636608

Sujet: LSS catalyzes the conversion of (S)-2,3 oxidosqualene to lanosterol. It is a member of the terpene cyclase/mutase family and catalyzes the first step in the biosynthesis of cholesterol, steroid hormones, and vitamin D. Two transcript variants encoding the same protein have been found for this gene.

Poids moléculaire: 83 kDa (MW of target protein)