Erythrocyte Ankyrin anticorps (Middle Region)

N° du produit ABIN631420

Cet anticorps Lapin Polyclonal détecte spécifiquement Erythrocyte Ankyrin dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour Erythrocyte Ankyrin anticorps (Middle Region) (ABIN631420)

Antigène: Erythrocyte Ankyrin (ANK1) (Ankyrin 1, Erythrocytic (ANK1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Erythrocyte Ankyrin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Erythrocyte Ankyrin anticorps

Épitope: Middle Region

Specificité: Ankyrin 1 antibody was raised against the middle region of ANK1

Purification: Affinity purified

Immunogène: Ankyrin 1 antibody was raised using the middle region of ANK1 corresponding to a region with amino acids PCAMPETVVIRSEEQEQASKEYDEDSLIPSSPATETSDNISPVASPVHTG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Ankyrin 1 Blocking Peptide, (ABIN5612073), is also available for use as a blocking control in assays to test for specificity of this Ankyrin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Erythrocyte Ankyrin

Antigène: Erythrocyte Ankyrin (ANK1) (Ankyrin 1, Erythrocytic (ANK1))

Autre désignation: Ankyrin 1

Sujet: Ankyrins are a family of proteins that are believed to link the integral membrane proteins to the underlying spectrin-actin cytoskeleton and play key roles in activities such as cell motility, activation and proliferation.

Poids moléculaire: 189 kDa (MW of target protein)

Pathways: Synaptic Membrane