Erythrocyte Ankyrin anticorps (Middle Region)

N° du produit ABIN631420

Détail du produit anti-Erythrocyte Ankyrin anticorps

Antigène: Erythrocyte Ankyrin (ANK1) (Ankyrin 1, Erythrocytic (ANK1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Erythrocyte Ankyrin est non-conjugé

Application: Western Blotting (WB)

Specificité: Ankyrin 1 antibody was raised against the middle region of ANK1

Purification: Affinity purified

Immunogène: Ankyrin 1 antibody was raised using the middle region of ANK1 corresponding to a region with amino acids PCAMPETVVIRSEEQEQASKEYDEDSLIPSSPATETSDNISPVASPVHTG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Ankyrin 1 Blocking Peptide, catalog no. 33R-6993, is also available for use as a blocking control in assays to test for specificity of this Ankyrin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Erythrocyte Ankyrin

Antigène: Erythrocyte Ankyrin (ANK1) (Ankyrin 1, Erythrocytic (ANK1))

Autre désignation: Ankyrin 1 (ANK1 Produits)

Synonymes: anticorps CHANK1, anticorps wu:fa09h06, anticorps zgc:101835, anticorps ank, anticorps sph1, anticorps sph2, anticorps ANK1, anticorps ANK, anticorps SPH1, anticorps SPH2, anticorps Ank-1, anticorps nb, anticorps pale, anticorps ankyrin 1, anticorps ankyrin 1, erythrocytic a, anticorps ankyrin 1 L homeolog, anticorps ankyrin 1, erythrocytic, anticorps ankyrin 1, erythroid, anticorps ANK1, anticorps ank1a, anticorps ank1, anticorps ank1.L, anticorps Ank1

Sujet: Ankyrins are a family of proteins that are believed to link the integral membrane proteins to the underlying spectrin-actin cytoskeleton and play key roles in activities such as cell motility, activation and proliferation.

Poids moléculaire: 189 kDa (MW of target protein)

Pathways: Synaptic Membrane