EXOC3 anticorps (Middle Region)
-
- Antigène Voir toutes EXOC3 Anticorps
- EXOC3 (Exocyst Complex Component 3 (EXOC3))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EXOC3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EXOC3 antibody was raised against the middle region of EXOC3
- Purification
- Affinity purified
- Immunogène
- EXOC3 antibody was raised using the middle region of EXOC3 corresponding to a region with amino acids LERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCF
- Top Product
- Discover our top product EXOC3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EXOC3 Blocking Peptide, catalog no. 33R-4927, is also available for use as a blocking control in assays to test for specificity of this EXOC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EXOC3 (Exocyst Complex Component 3 (EXOC3))
- Autre désignation
- EXOC3 (EXOC3 Produits)
- Synonymes
- anticorps CG5341, anticorps Dmel\\CG5341, anticorps Dsec6, anticorps Sec6, anticorps Sec6p, anticorps dsec6, anticorps sec 6, anticorps F14O23.20, anticorps F14O23_20, anticorps sec6l1, anticorps fi26g09, anticorps wu:fi26g09, anticorps wu:fi34a09, anticorps wu:fj62h05, anticorps wu:fk66f08, anticorps zgc:55709, anticorps SEC6L1, anticorps SEC6, anticorps 2810050O03Rik, anticorps E430013E20Rik, anticorps Sec6l1, anticorps rSec6, anticorps Secretory 6, anticorps SEC6, anticorps exocyst complex component 3, anticorps Exocyst complex component 3, anticorps Sec6, anticorps SEC6, anticorps EXOC3, anticorps exoc3, anticorps Exoc3, anticorps sec-6
- Sujet
- EXOC3 is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery.
- Poids moléculaire
- 85 kDa (MW of target protein)
- Pathways
- Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis
-