MYO1E anticorps (Middle Region)
-
- Antigène Voir toutes MYO1E Anticorps
- MYO1E (Myosin IE (MYO1E))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MYO1E est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Myosin Ie antibody was raised against the middle region of MYO1 E
- Purification
- Affinity purified
- Immunogène
- Myosin Ie antibody was raised using the middle region of MYO1 E corresponding to a region with amino acids PKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGR
- Top Product
- Discover our top product MYO1E Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Myosin Ie Blocking Peptide, catalog no. 33R-7176, is also available for use as a blocking control in assays to test for specificity of this Myosin Ie antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYO0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MYO1E (Myosin IE (MYO1E))
- Autre désignation
- Myosin Ie (MYO1E Produits)
- Synonymes
- anticorps FSGS6, anticorps HuncM-IC, anticorps MYO1C, anticorps MYR5, anticorps Myr3, anticorps 2310020N23Rik, anticorps 9130023P14Rik, anticorps AA407778, anticorps myosin-1e, anticorps myr 3, anticorps myo1e, anticorps wu:fc15g04, anticorps wu:fe49h01, anticorps myosin IE, anticorps myosin IE, a, anticorps MYO1E, anticorps Myo1e, anticorps myo1ea
- Sujet
- Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments.
- Poids moléculaire
- 127 kDa (MW of target protein)
- Pathways
- Platelet-derived growth Factor Receptor Signaling
-