BPGM anticorps (C-Term)
-
- Antigène Voir toutes BPGM Anticorps
- BPGM (2,3-bisphosphoglycerate Mutase (BPGM))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BPGM est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- BPGM antibody was raised against the C terminal of BPGM
- Purification
- Affinity purified
- Immunogène
- BPGM antibody was raised using the C terminal of BPGM corresponding to a region with amino acids LPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQAKK
- Top Product
- Discover our top product BPGM Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
BPGM Blocking Peptide, catalog no. 33R-5292, is also available for use as a blocking control in assays to test for specificity of this BPGM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BPGM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- BPGM (2,3-bisphosphoglycerate Mutase (BPGM))
- Autre désignation
- BPGM (BPGM Produits)
- Synonymes
- anticorps DPGM, anticorps AI323730, anticorps AL022789, anticorps C86192, anticorps Ab2-098, anticorps zgc:92230, anticorps Bisphosphoglycerate mutase, anticorps bisphosphoglycerate mutase, anticorps 2,3-bisphosphoglycerate mutase, anticorps bisphosphoglycerate mutase S homeolog, anticorps pmge, anticorps BPGM, anticorps Bpgm, anticorps bpgm, anticorps bpgm.S
- Sujet
- BPGM belongs to the phosphoglycerate mutase family, BPG-dependent PGAM subfamily. It plays a major role in regulating hemoglobin oxygen affinity as a consequence of controlling 2,3-BPG concentration. It can also catalyze the reaction of EC 5.4.2.1 (mutase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.
- Poids moléculaire
- 28 kDa (MW of target protein)
-