SHMT1 anticorps

N° du produit ABIN631508

L’anticorps anti-SHMT1 Polyclonal Lapin est utilisé pour la détection de SHMT1 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour SHMT1 anticorps (ABIN631508)

Antigène: SHMT1 (serine Hydroxymethyltransferase 1 (Soluble) (SHMT1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SHMT1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SHMT1 anticorps

Purification: Affinity purified

Immunogène: SHMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SHMT1 Blocking Peptide, (ABIN5616132), is also available for use as a blocking control in assays to test for specificity of this SHMT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHMT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SHMT1

Antigène: SHMT1 (serine Hydroxymethyltransferase 1 (Soluble) (SHMT1))

Autre désignation: SHMT1

Sujet: This gene encodes the cellular form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. This reaction provides one carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative splicing of this gene results in 2 transcript variants encoding 2 different isoforms. Additional transcript variants have been described, but their biological validity has not been determined.

Poids moléculaire: 53 kDa (MW of target protein)