SHMT1 anticorps
-
- Antigène Voir toutes SHMT1 Anticorps
- SHMT1 (serine Hydroxymethyltransferase 1 (Soluble) (SHMT1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SHMT1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SHMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG
- Top Product
- Discover our top product SHMT1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SHMT1 Blocking Peptide, catalog no. 33R-6720, is also available for use as a blocking control in assays to test for specificity of this SHMT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHMT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SHMT1 (serine Hydroxymethyltransferase 1 (Soluble) (SHMT1))
- Autre désignation
- SHMT1 (SHMT1 Produits)
- Synonymes
- anticorps Shmt, anticorps mShmt, anticorps LRRGT00032, anticorps shmt1, anticorps MGC53442, anticorps zgc:66171, anticorps zgc:77524, anticorps SHMT1, anticorps Shmt1, anticorps CSHMT, anticorps SHMT, anticorps AI324848, anticorps AI385541, anticorps C81125, anticorps mshmt, anticorps mshmt1, anticorps mshmt2, anticorps MEL-32, anticorps SHMT2, anticorps F20D10.50, anticorps F20D10_50, anticorps SERINE HYDROXYMETHYLTRANSFERASE 1, anticorps SERINE TRANSHYDROXYMETHYLASE, anticorps SERINE TRANSHYDROXYMETHYLTRANSFERASE, anticorps STM, anticorps serine transhydroxymethyltransferase 1, anticorps serine hydroxymethyltransferase 1, anticorps serine hydroxymethyltransferase 1 (soluble) L homeolog, anticorps serine hydroxymethyltransferase 1 (soluble), anticorps microRNA 6778, anticorps serine transhydroxymethyltransferase 1, anticorps Shmt1, anticorps shmt1.L, anticorps shmt1, anticorps MIR6778, anticorps SHMT1, anticorps SHM1
- Sujet
- This gene encodes the cellular form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. This reaction provides one carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative splicing of this gene results in 2 transcript variants encoding 2 different isoforms. Additional transcript variants have been described, but their biological validity has not been determined.
- Poids moléculaire
- 53 kDa (MW of target protein)
-