NEXN anticorps

N° du produit ABIN631522

Détail du produit anti-NEXN anticorps

Antigène: NEXN (Nexilin (NEXN))

Reactivité: Rat, Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NEXN est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Nexilin antibody was raised using a synthetic peptide corresponding to a region with amino acids EELERQRQENRKKQAEEEARKRLEEEKRAFEEARRQMVNEDEENQDTAKI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Nexilin Blocking Peptide, catalog no. 33R-2372, is also available for use as a blocking control in assays to test for specificity of this Nexilin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEXN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NEXN

Antigène: NEXN (Nexilin (NEXN))

Autre désignation: Nexilin (NEXN Produits)

Synonymes: anticorps 1110046H09Rik, anticorps AA553326, anticorps NELIN, anticorps CMH20, anticorps nexilin, anticorps nexilin F-actin binding protein, anticorps nexilin F-actin binding protein S homeolog, anticorps nexilin (F actin binding protein), anticorps LOC100422793, anticorps nexn, anticorps Nexn, anticorps nexn.S, anticorps NEXN

Sujet: NEXN is involved in regulating cell migration through association with the actin cytoskeleton.

Poids moléculaire: 81 kDa (MW of target protein)