METTL7B anticorps (Middle Region)

N° du produit ABIN631547

Détail du produit anti-METTL7B anticorps

Antigène: METTL7B (Methyltransferase Like 7B (METTL7B))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp METTL7B est non-conjugé

Application: Western Blotting (WB)

Specificité: METTL7 B antibody was raised against the middle region of METTL7

Purification: Affinity purified

Immunogène: METTL7 B antibody was raised using the middle region of METTL7 corresponding to a region with amino acids FVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

METTL7B Blocking Peptide, catalog no. 33R-3123, is also available for use as a blocking control in assays to test for specificity of this METTL7B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur METTL7B

Antigène: METTL7B (Methyltransferase Like 7B (METTL7B))

Autre désignation: METTL7B (METTL7B Produits)

Synonymes: anticorps ALDI, anticorps 0610006F02Rik, anticorps AI266817, anticorps RGD1305205, anticorps methyltransferase like 7B, anticorps METTL7B, anticorps Mettl7b

Sujet: METTL7B belongs to the methyltransferase superfamily. It is a probable methyltransferase.

Poids moléculaire: 22 kDa (MW of target protein)