PCSK4 anticorps (N-Term)

N° du produit ABIN631599

Détail du produit anti-PCSK4 anticorps

Antigène: PCSK4 (Proprotein Convertase Subtilisin/kexin Type 4 (PCSK4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCSK4 est non-conjugé

Application: Western Blotting (WB)

Specificité: PCSK4 antibody was raised against the N terminal of PCSK4

Purification: Affinity purified

Immunogène: PCSK4 antibody was raised using the N terminal of PCSK4 corresponding to a region with amino acids VSSWAVQVSQGNREVERLARKFGFVNLGPIFPDGQYFHLRHRGVVQQSLT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCSK4 Blocking Peptide, catalog no. 33R-9828, is also available for use as a blocking control in assays to test for specificity of this PCSK4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCSK4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCSK4

Antigène: PCSK4 (Proprotein Convertase Subtilisin/kexin Type 4 (PCSK4))

Autre désignation: PCSK4 (PCSK4 Produits)

Synonymes: anticorps PC4, anticorps SPC5, anticorps AI647044, anticorps L21221, anticorps NEC 3, anticorps NEC3, anticorps PCSK4, anticorps pc4, anticorps spc5, anticorps MGC146505, anticorps pcsk4, anticorps proprotein convertase subtilisin/kexin type 4, anticorps proprotein convertase subtilisin/kexin type 4 L homeolog, anticorps PCSK4, anticorps Pcsk4, anticorps pcsk4, anticorps pcsk4.L

Sujet: PCSK4 is involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. PCSK4 plays a role in transcriptional coactivation. PCSK4 may be involved in stabilizing the multiprotein transcription complex.Proprotein convertases, including PCSK4, are calcium-dependent serine proteases related to bacterial subtilisins and to yeast kexin.

Poids moléculaire: 83 kDa (MW of target protein)