AGO4 anticorps (Middle Region)

N° du produit ABIN631614

Détail du produit anti-AGO4 anticorps

Antigène: AGO4 (EIF2C4) (Eukaryotic Translation Initiation Factor 2C, 4 (EIF2C4))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AGO4 est non-conjugé

Application: Western Blotting (WB)

Specificité: EIF2 C4 antibody was raised against the middle region of EIF2 4

Purification: Affinity purified

Immunogène: EIF2 C4 antibody was raised using the middle region of EIF2 4 corresponding to a region with amino acids DGHPSRYCATVRVQTSRQEISQELLYSQEVIQDLTNMVRELLIQFYKSTR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF2C4 Blocking Peptide, catalog no. 33R-1952, is also available for use as a blocking control in assays to test for specificity of this EIF2C4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AGO4

Antigène: AGO4 (EIF2C4) (Eukaryotic Translation Initiation Factor 2C, 4 (EIF2C4))

Autre désignation: EIF2C4 (EIF2C4 Produits)

Synonymes: anticorps EIF2C4, anticorps ago4, anticorps Argonaute4, anticorps argonaute-4, anticorps eif2c4, anticorps wu:fd14f04, anticorps ARGONAUTE 4, anticorps OCP11, anticorps OVEREXPRESSOR OF CATIONIC PEROXIDASE 11, anticorps T20P8.9, anticorps T20P8_9, anticorps Eif2c4, anticorps 5730550L01Rik, anticorps AI481660, anticorps argonaute 4, RISC catalytic component, anticorps argonaute 1, RISC catalytic component, anticorps argonaute RISC catalytic component 4, anticorps Argonaute family protein, anticorps argonaute 4, RISC catalytic component L homeolog, anticorps argonaute RISC catalytic subunit 4, anticorps AGO4, anticorps ago1, anticorps ago4, anticorps Ago4, anticorps ago4.L

Sujet: This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing.

Poids moléculaire: 95 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Cellular Glucan Metabolic Process