CHN2 anticorps
-
- Antigène Voir toutes CHN2 Anticorps
- CHN2 (Chimerin (Chimaerin) 2 (CHN2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CHN2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CHN2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQC
- Top Product
- Discover our top product CHN2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CHN2 Blocking Peptide, catalog no. 33R-6714, is also available for use as a blocking control in assays to test for specificity of this CHN2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CHN2 (Chimerin (Chimaerin) 2 (CHN2))
- Autre désignation
- CHN2 (CHN2 Produits)
- Synonymes
- anticorps 1700026N20Rik, anticorps 4930557O16Rik, anticorps ARHGAP3, anticorps Bch, anticorps BCH, anticorps CHN2-3, anticorps RHOGAP3, anticorps chimerin 2, anticorps chimerin 2 L homeolog, anticorps chn2, anticorps CHN2, anticorps Chn2, anticorps chn2.L
- Sujet
- CHN2 is a protein with a phorbol-ester/DAG-type zinc finger, a Rho-GAP domain and an SH2 domain. This protein has GTPase-activating protein activity that is regulated by phospholipid binding and binding of diacylglycerol (DAG) induces translocation of the protein from the cytosol to the Golgi apparatus membrane. CHN2 plays a role in the proliferation and migration of smooth muscle cells. Decreased expression of this gene is associated with high-grade gliomas and breast tumors, and increased expression of this gene is associated with lymphomas. Mutations in this gene have been associated with schizophrenia in men.
- Poids moléculaire
- 38 kDa (MW of target protein)
-