CHN2 anticorps

N° du produit ABIN631637

L’anticorps anti-CHN2 Polyclonal Lapin est utilisé pour la détection de CHN2 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour CHN2 anticorps (ABIN631637)

Antigène: CHN2 (Chimerin (Chimaerin) 2 (CHN2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHN2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CHN2 anticorps

Purification: Affinity purified

Immunogène: CHN2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHN2 Blocking Peptide, (ABIN5612853), is also available for use as a blocking control in assays to test for specificity of this CHN2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHN2

Antigène: CHN2 (Chimerin (Chimaerin) 2 (CHN2))

Autre désignation: CHN2

Sujet: CHN2 is a protein with a phorbol-ester/DAG-type zinc finger, a Rho-GAP domain and an SH2 domain. This protein has GTPase-activating protein activity that is regulated by phospholipid binding and binding of diacylglycerol (DAG) induces translocation of the protein from the cytosol to the Golgi apparatus membrane. CHN2 plays a role in the proliferation and migration of smooth muscle cells. Decreased expression of this gene is associated with high-grade gliomas and breast tumors, and increased expression of this gene is associated with lymphomas. Mutations in this gene have been associated with schizophrenia in men.

Poids moléculaire: 38 kDa (MW of target protein)