ACTN3 anticorps (N-Term)
-
- Antigène Voir toutes ACTN3 Anticorps
- ACTN3 (Actinin, alpha 3 (ACTN3))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACTN3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Alpha Actinin 3 antibody was raised against the N terminal of ACTN3
- Purification
- Affinity purified
- Immunogène
- alpha Actinin 3 antibody was raised using the N terminal of ACTN3 corresponding to a region with amino acids VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY
- Top Product
- Discover our top product ACTN3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Alpha Actinin 3 Blocking Peptide, catalog no. 33R-9753, is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACTN3 (Actinin, alpha 3 (ACTN3))
- Autre désignation
- alpha Actinin 3 (ACTN3 Produits)
- Synonymes
- anticorps CG8953, anticorps Dmel\\CG8953, anticorps ORF1, anticorps acta-3, anticorps dabp, anticorps ACTN2, anticorps actn3, anticorps actnl, anticorps zgc:63559, anticorps fb95c03, anticorps wu:fb95c03, anticorps wu:fc11d03, anticorps zgc:77243, anticorps actinin alpha 3 (gene/pseudogene), anticorps actinin alpha 3, anticorps alpha actinin 3, anticorps actinin alpha 3a, anticorps actinin alpha 3 (gene/pseudogene) L homeolog, anticorps alpha-actinin-3, anticorps actinin alpha 3b, anticorps ACTN3, anticorps Actn3, anticorps actn3a, anticorps actn3.L, anticorps actn3, anticorps LOC100439754, anticorps actn3b
- Sujet
- Alpha-actinin is an actin-binding protein with multiple roles in different cell types. This protein expression is limited to skeletal muscle. It is localized to the Z-disc and analogous dense bodies, where it helps to anchor the myofibrillar actin filaments.
- Poids moléculaire
- 103 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-