UCHL3 anticorps

N° du produit ABIN631699

Cet anticorps Lapin Polyclonal détecte spécifiquement UCHL3 dans WB. Il présente une réactivité avec des échantillons de Humain, Rat et Souris.

Aperçu rapide pour UCHL3 anticorps (ABIN631699)

Antigène: UCHL3 (Uchl3) (Ubiquitin Carboxyl-terminal Esterase L3 (Ubiquitin Thiolesterase) (Uchl3))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UCHL3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UCHL3 anticorps

Purification: Affinity purified

Immunogène: UCHL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UCHL3 Blocking Peptide, (ABIN5616893), is also available for use as a blocking control in assays to test for specificity of this UCHL3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCHL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UCHL3

Antigène: UCHL3 (Uchl3) (Ubiquitin Carboxyl-terminal Esterase L3 (Ubiquitin Thiolesterase) (Uchl3))

Autre désignation: UCHL3

Sujet: UCHL3 is an ubiquitin-protein hydrolase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognises and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Feeding Behaviour, Positive Regulation of fat Cell Differentiation