UCHL3 anticorps
-
- Antigène Voir toutes UCHL3 (Uchl3) Anticorps
- UCHL3 (Uchl3) (Ubiquitin Carboxyl-terminal Esterase L3 (Ubiquitin Thiolesterase) (Uchl3))
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UCHL3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- UCHL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC
- Top Product
- Discover our top product Uchl3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UCHL3 Blocking Peptide, catalog no. 33R-5920, is also available for use as a blocking control in assays to test for specificity of this UCHL3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCHL3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UCHL3 (Uchl3) (Ubiquitin Carboxyl-terminal Esterase L3 (Ubiquitin Thiolesterase) (Uchl3))
- Autre désignation
- UCHL3 (Uchl3 Produits)
- Synonymes
- anticorps UCH-L3, anticorps UCH-6, anticorps RGD1561196, anticorps im:6908825, anticorps zgc:109963, anticorps uchl4, anticorps ubiquitin C-terminal hydrolase L3, anticorps ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase), anticorps ubiquitin C-terminal hydrolase L3 L homeolog, anticorps UCHL3, anticorps Uchl3, anticorps uchl3, anticorps uchl3.L
- Sujet
- UCHL3 is an ubiquitin-protein hydrolase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognises and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8.
- Poids moléculaire
- 25 kDa (MW of target protein)
- Pathways
- Feeding Behaviour, Positive Regulation of fat Cell Differentiation
-