HSD17B1 anticorps

N° du produit ABIN631774

Détail du produit anti-HSD17B1 anticorps

Antigène: HSD17B1 (Hydroxysteroid (17-Beta) Dehydrogenase 1 (HSD17B1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSD17B1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: HSD17 B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAA

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HSD17B1 Blocking Peptide, catalog no. 33R-5737, is also available for use as a blocking control in assays to test for specificity of this HSD17B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HSD17B1

Antigène: HSD17B1 (Hydroxysteroid (17-Beta) Dehydrogenase 1 (HSD17B1))

Autre désignation: HSD17B1 (HSD17B1 Produits)

Synonymes: anticorps EDH17B2, anticorps EDHB17, anticorps HSD17, anticorps SDR28C1, anticorps 17HSDB1, anticorps 17beta-HSD, anticorps E2DH, anticorps Hsd17ba, anticorps 17BHD1, anticorps zfHSD17B1, anticorps hydroxysteroid 17-beta dehydrogenase 1, anticorps hydroxysteroid (17-beta) dehydrogenase 1, anticorps HSD17B1, anticorps Hsd17b1, anticorps hsd17b1

Sujet: HSD17B1 is favors the reduction of estrogens and androgens. It also has 20-alpha-HSD activity. It uses preferentially NADH.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis