CAD anticorps (Middle Region)

N° du produit ABIN631789

Détail du produit anti-CAD anticorps

Antigène: CAD (Carbamoyl-Phosphate Synthetase 2, Aspartate Transcarbamylase, and Dihydroorotase (CAD))

Épitope: Middle Region

Reactivité: Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CAD est non-conjugé

Application: Western Blotting (WB)

Specificité: CAD antibody was raised against the middle region of CAD

Purification: Affinity purified

Immunogène: CAD antibody was raised using the middle region of CAD corresponding to a region with amino acids SVSNNNRTSPSKPPYFDWMKKPAYPAQPQPGKTRTKDKYRVVYTDFQRLE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CAD Blocking Peptide, catalog no. 33R-8934, is also available for use as a blocking control in assays to test for specificity of this CAD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CAD

Antigène: CAD (Carbamoyl-Phosphate Synthetase 2, Aspartate Transcarbamylase, and Dihydroorotase (CAD))

Autre désignation: CAD (CAD Produits)

Synonymes: anticorps Cpad, anticorps AU018859, anticorps 2410008J01Rik, anticorps cb456, anticorps wu:fc30c12, anticorps wu:fc33d01, anticorps wu:fc67g02, anticorps si:dkey-221h15.3, anticorps CAD, anticorps xcad, anticorps carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase, anticorps CAD, anticorps Cad, anticorps cad

Sujet: Cad regulates embryonic abdominal segment formation by zygotically activating expression of knirps (kni) and giant (gt). It plays a role in the establishment of the hindgut and in the invagination of the hindgut primordium during gastrulation. These effects on the gut are achieved by acting combinatorially at the posterior of the embryo to activate transcription of different targets, including folded gastrulation (fog), fork head (fkh) and wingless (wg).

Poids moléculaire: 46 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response, Ribonucleoside Biosynthetic Process