HIPK4 anticorps (Middle Region)

N° du produit ABIN631807

Détail du produit anti-HIPK4 anticorps

Antigène: HIPK4 (Homeodomain Interacting Protein Kinase 4 (HIPK4))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HIPK4 est non-conjugé

Application: Western Blotting (WB)

Specificité: HIPK4 antibody was raised against the middle region of HIPK4

Purification: Affinity purified

Immunogène: HIPK4 antibody was raised using the middle region of HIPK4 corresponding to a region with amino acids AEEKEAAGMGSVAGSSPFFREEKAPGMQRAIDQLDDLSLQEAGHGLWGET

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HIPK4 Blocking Peptide, catalog no. 33R-1123, is also available for use as a blocking control in assays to test for specificity of this HIPK4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIPK4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HIPK4

Antigène: HIPK4 (Homeodomain Interacting Protein Kinase 4 (HIPK4))

Autre désignation: HIPK4 (HIPK4 Produits)

Synonymes: anticorps Gm162, anticorps homeodomain interacting protein kinase 4, anticorps HIPK4, anticorps Hipk4

Sujet: HIPK4 is a protein kinase that phosphorylates human TP53 at Ser-9, and thus induces TP53 repression of BIRC5 promoter. It may act as a corepressor of transcription factors.

Poids moléculaire: 69 kDa (MW of target protein)