HIPK4 anticorps (Middle Region)
-
- Antigène Voir toutes HIPK4 Anticorps
- HIPK4 (Homeodomain Interacting Protein Kinase 4 (HIPK4))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HIPK4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HIPK4 antibody was raised against the middle region of HIPK4
- Purification
- Affinity purified
- Immunogène
- HIPK4 antibody was raised using the middle region of HIPK4 corresponding to a region with amino acids AEEKEAAGMGSVAGSSPFFREEKAPGMQRAIDQLDDLSLQEAGHGLWGET
- Top Product
- Discover our top product HIPK4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HIPK4 Blocking Peptide, catalog no. 33R-1123, is also available for use as a blocking control in assays to test for specificity of this HIPK4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIPK4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HIPK4 (Homeodomain Interacting Protein Kinase 4 (HIPK4))
- Autre désignation
- HIPK4 (HIPK4 Produits)
- Synonymes
- anticorps Gm162, anticorps homeodomain interacting protein kinase 4, anticorps HIPK4, anticorps Hipk4
- Sujet
- HIPK4 is a protein kinase that phosphorylates human TP53 at Ser-9, and thus induces TP53 repression of BIRC5 promoter. It may act as a corepressor of transcription factors.
- Poids moléculaire
- 69 kDa (MW of target protein)
-