ERCC6L anticorps (N-Term)
-
- Antigène Voir toutes ERCC6L Anticorps
- ERCC6L (Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 6-Like (ERCC6L))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ERCC6L est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ERCC6 L antibody was raised against the N terminal Of Ercc6
- Purification
- Affinity purified
- Immunogène
- ERCC6 L antibody was raised using the N terminal Of Ercc6 corresponding to a region with amino acids GDLEEAFKLFNLAKDIFPNEKVLSRIQKIQEALEELAEQGDDEFTDVCNS
- Top Product
- Discover our top product ERCC6L Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ERCC6L Blocking Peptide, catalog no. 33R-3202, is also available for use as a blocking control in assays to test for specificity of this ERCC6L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERCC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ERCC6L (Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 6-Like (ERCC6L))
- Autre désignation
- ERCC6L (ERCC6L Produits)
- Synonymes
- anticorps PICH, anticorps RAD26L, anticorps BC004701, anticorps D330021P09Rik, anticorps RGD1565734, anticorps fc22h03, anticorps si:ch211-278b8.3, anticorps wu:fc22h03, anticorps ERCC excision repair 6 like, spindle assembly checkpoint helicase, anticorps excision repair cross-complementing rodent repair deficiency complementation group 6 like, anticorps DNA excision repair protein ERCC-6-like, anticorps excision repair cross-complementation group 6-like, anticorps ERCC6L, anticorps Ercc6l, anticorps LOC100373376, anticorps LOC100494766, anticorps LOC100552957, anticorps LOC100560751, anticorps LOC100563247, anticorps ercc6l
- Sujet
- ERCC6L is a DNA helicase that acts as an essential component of the spindle assembly checkpoint.ERCC6L contributes to the mitotic checkpoint by recruiting MAD2 to kinetochores and monitoring tension on centromeric chromatin. ERCC6L acts as a tension sensor that associates with catenated DNA which is stretched under tension until it is resolved during anaphase.
- Poids moléculaire
- 141 kDa (MW of target protein)
-