KIFAP3 anticorps (Middle Region)

N° du produit ABIN631820

Détail du produit anti-KIFAP3 anticorps

Antigène: KIFAP3 (Kinesin Associated Protein 3 (KIFAP3))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIFAP3 est non-conjugé

Application: Western Blotting (WB)

Specificité: KIFAP3 antibody was raised against the middle region of KIFAP3

Purification: Affinity purified

Immunogène: KIFAP3 antibody was raised using the middle region of KIFAP3 corresponding to a region with amino acids WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIFAP3 Blocking Peptide, catalog no. 33R-9970, is also available for use as a blocking control in assays to test for specificity of this KIFAP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIFAP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIFAP3

Antigène: KIFAP3 (Kinesin Associated Protein 3 (KIFAP3))

Autre désignation: KIFAP3 (KIFAP3 Produits)

Synonymes: anticorps CG11759, anticorps DmKAP, anticorps DmKap, anticorps Dmel\\CG11759, anticorps KAP, anticorps KAP3, anticorps Kap, anticorps dKAP3, anticorps kap3, anticorps FLA3, anticorps KAP-1, anticorps KAP-3, anticorps SMAP, anticorps Smg-GDS, anticorps dJ190I16.1, anticorps fb99h08, anticorps kifap3, anticorps wu:fb99h08, anticorps wz7228, anticorps Kinesin associated protein 3, anticorps kinesin-associated protein 3, anticorps kinesin associated protein 3, anticorps kinesin-associated protein 3b, anticorps kinesin-associated protein 3 L homeolog, anticorps Kap3, anticorps LOC551999, anticorps KIFAP3, anticorps Kifap3, anticorps kifap3b, anticorps kifap3.L

Sujet: The small G protein GDP dissociation stimulator (smg GDS) is a regulator protein having two activities on a group of small G proteins including the Rho and Rap1 family members and Ki-Ras, one is to stimulate their GDP/GTP exchange reactions, and the other is to inhibit their interactions with membranes.

Poids moléculaire: 91 kDa (MW of target protein)

Pathways: Signalisation Hedgehog, Sensory Perception of Sound