TBCK anticorps (Middle Region)
-
- Antigène Tous les produits TBCK
- TBCK (TBC1 Domain Containing Kinase (TBCK))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TBCK est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MGC16169 antibody was raised against the middle region of Mgc16169
- Purification
- Affinity purified
- Immunogène
- MGC16169 antibody was raised using the middle region of Mgc16169 corresponding to a region with amino acids PPICTLPNFLFEDGESFGQGRDRSSLLDDTTVTLSLCQLRNRLKDVGGEA
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MGC16169 Blocking Peptide, catalog no. 33R-7258, is also available for use as a blocking control in assays to test for specificity of this MGC16169 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC16169 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TBCK (TBC1 Domain Containing Kinase (TBCK))
- Abstract
- TBCK Produits
- Synonymes
- anticorps Tbckl, anticorps RGD1307816, anticorps tbckl, anticorps hspc302, anticorps MGC82809, anticorps im:7138354, anticorps wu:fc74a10, anticorps zgc:158710, anticorps MGC122549, anticorps TBCKL, anticorps 1700120J03Rik, anticorps 9430001M19, anticorps A630047E20Rik, anticorps C030007I09Rik, anticorps TBC1 domain containing kinase, anticorps TBC1 domain containing kinase L homeolog, anticorps Tbck, anticorps tbck.L, anticorps TBCK, anticorps tbck
- Sujet
- The function of MGC16169 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 94 kDa (MW of target protein)
-