TOM1L2 anticorps
-
- Antigène Voir toutes TOM1L2 Anticorps
- TOM1L2 (Target of Myb1-Like 2 (TOM1L2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TOM1L2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- TOM1 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPDLPSP
- Top Product
- Discover our top product TOM1L2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TOM1L2 Blocking Peptide, catalog no. 33R-7685, is also available for use as a blocking control in assays to test for specificity of this TOM1L2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOM0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TOM1L2 (Target of Myb1-Like 2 (TOM1L2))
- Autre désignation
- TOM1L2 (TOM1L2 Produits)
- Synonymes
- anticorps 2900016I08Rik, anticorps A730055F12Rik, anticorps AU042072, anticorps Srebf1, anticorps target of myb1 like 2 membrane trafficking protein, anticorps target of myb1 like 2 membrane trafficking protein L homeolog, anticorps target of myb1-like 2 (chicken), anticorps TOM1L2, anticorps tom1l2.L, anticorps Tom1l2
- Sujet
- TOM1L2 may regulate growth factor-induced mitogenic signaling.
- Poids moléculaire
- 55 kDa (MW of target protein)
-