UBQLN4 anticorps (Middle Region)

N° du produit ABIN631881

Détail du produit anti-UBQLN4 anticorps

Antigène: UBQLN4 (Ubiquilin 4 (UBQLN4))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBQLN4 est non-conjugé

Application: Western Blotting (WB)

Specificité: Ubiquilin 4 antibody was raised against the middle region of UBQLN4

Purification: Affinity purified

Immunogène: Ubiquilin 4 antibody was raised using the middle region of UBQLN4 corresponding to a region with amino acids TDIQEPMFSAAREQFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Ubiquilin 4 Blocking Peptide, catalog no. 33R-9011, is also available for use as a blocking control in assays to test for specificity of this Ubiquilin 4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBQLN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBQLN4

Antigène: UBQLN4 (Ubiquilin 4 (UBQLN4))

Autre désignation: Ubiquilin 4 (UBQLN4 Produits)

Synonymes: anticorps a1u, anticorps cip75, anticorps ubin, anticorps ubiquilin-4, anticorps A1U, anticorps A1Up, anticorps C1orf6, anticorps CIP75, anticorps UBIN, anticorps A1u, anticorps AI663987, anticorps RGD1308273, anticorps ubiquilin 4 L homeolog, anticorps ubiquilin 4, anticorps ubqln4.L, anticorps ubqln4, anticorps UBQLN4, anticorps Ubqln4

Sujet: The function of Ubiquilin 4 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 64 kDa (MW of target protein)