UBQLN4 anticorps (Middle Region)

N° du produit ABIN631881

Cet anticorps anti-UBQLN4 Polyclonal Lapin (ABIN631881) détecte spécifiquement UBQLN4 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour UBQLN4 anticorps (Middle Region) (ABIN631881)

Antigène: UBQLN4 (Ubiquilin 4 (UBQLN4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBQLN4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UBQLN4 anticorps

Épitope: Middle Region

Specificité: Ubiquilin 4 antibody was raised against the middle region of UBQLN4

Purification: Affinity purified

Immunogène: Ubiquilin 4 antibody was raised using the middle region of UBQLN4 corresponding to a region with amino acids TDIQEPMFSAAREQFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Ubiquilin 4 Blocking Peptide, (ABIN5616884), is also available for use as a blocking control in assays to test for specificity of this Ubiquilin 4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBQLN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBQLN4

Antigène: UBQLN4 (Ubiquilin 4 (UBQLN4))

Autre désignation: Ubiquilin 4

Sujet: The function of Ubiquilin 4 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 64 kDa (MW of target protein)