CYP26B1 anticorps (Middle Region)
-
- Antigène Voir toutes CYP26B1 Anticorps
- CYP26B1 (Cytochrome P450, Family 26, Subfamily B, Polypeptide 1 (CYP26B1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CYP26B1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CYP26 B1 antibody was raised against the middle region of CYP26 1
- Purification
- Affinity purified
- Immunogène
- CYP26 B1 antibody was raised using the middle region of CYP26 1 corresponding to a region with amino acids SRFELATRTFPRITLVPVLHPVDGLSVKFFGLDSNQNEILPETEAMLSAT
- Top Product
- Discover our top product CYP26B1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CYP26B1 Blocking Peptide, catalog no. 33R-8748, is also available for use as a blocking control in assays to test for specificity of this CYP26B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP20 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CYP26B1 (Cytochrome P450, Family 26, Subfamily B, Polypeptide 1 (CYP26B1))
- Autre désignation
- CYP26B1 (CYP26B1 Produits)
- Synonymes
- anticorps cyp26b1, anticorps cyp26a2, anticorps p450rai-2, anticorps CYP26A2, anticorps P450RAI-2, anticorps P450RAI2, anticorps RHFCA, anticorps CP26, anticorps fc21d03, anticorps wu:fc21d03, anticorps wu:fc26h10, anticorps zgc:76999, anticorps cytochrome P450 26B1, anticorps cytochrome P450 family 26 subfamily B member 1 L homeolog, anticorps cytochrome P450 family 26 subfamily B member 1, anticorps cytochrome P450, family 26, subfamily B, polypeptide 1, anticorps cytochrome P450, family 26, subfamily b, polypeptide 1, anticorps CpipJ_CPIJ002537, anticorps cyp26b1.L, anticorps CYP26B1, anticorps cyp26b1, anticorps Cyp26b1
- Sujet
- This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and the synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene is involved in the specific inactivation of all-trans-retinoic acid to hydroxylated forms, such as 4-oxo-, 4-OH-, and 18-OH-all-trans-retinoic acid.
- Poids moléculaire
- 57 kDa (MW of target protein)
- Pathways
- Retinoic Acid Receptor Signaling Pathway, Regulation of Muscle Cell Differentiation, Monocarboxylic Acid Catabolic Process
-