CYP26B1 anticorps (Middle Region)

N° du produit ABIN631961

Détail du produit anti-CYP26B1 anticorps

Antigène: CYP26B1 (Cytochrome P450, Family 26, Subfamily B, Polypeptide 1 (CYP26B1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYP26B1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CYP26 B1 antibody was raised against the middle region of CYP26 1

Purification: Affinity purified

Immunogène: CYP26 B1 antibody was raised using the middle region of CYP26 1 corresponding to a region with amino acids SRFELATRTFPRITLVPVLHPVDGLSVKFFGLDSNQNEILPETEAMLSAT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYP26B1 Blocking Peptide, catalog no. 33R-8748, is also available for use as a blocking control in assays to test for specificity of this CYP26B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP20 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CYP26B1

Antigène: CYP26B1 (Cytochrome P450, Family 26, Subfamily B, Polypeptide 1 (CYP26B1))

Autre désignation: CYP26B1 (CYP26B1 Produits)

Synonymes: anticorps cyp26b1, anticorps cyp26a2, anticorps p450rai-2, anticorps CYP26A2, anticorps P450RAI-2, anticorps P450RAI2, anticorps RHFCA, anticorps CP26, anticorps fc21d03, anticorps wu:fc21d03, anticorps wu:fc26h10, anticorps zgc:76999, anticorps cytochrome P450 26B1, anticorps cytochrome P450 family 26 subfamily B member 1 L homeolog, anticorps cytochrome P450 family 26 subfamily B member 1, anticorps cytochrome P450, family 26, subfamily B, polypeptide 1, anticorps cytochrome P450, family 26, subfamily b, polypeptide 1, anticorps CpipJ_CPIJ002537, anticorps cyp26b1.L, anticorps CYP26B1, anticorps cyp26b1, anticorps Cyp26b1

Sujet: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and the synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene is involved in the specific inactivation of all-trans-retinoic acid to hydroxylated forms, such as 4-oxo-, 4-OH-, and 18-OH-all-trans-retinoic acid.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Retinoic Acid Receptor Signaling Pathway, Regulation of Muscle Cell Differentiation, Monocarboxylic Acid Catabolic Process