NOB1 anticorps

N° du produit ABIN631975

Détail du produit anti-NOB1 anticorps

Antigène: NOB1 (RNA-Binding Protein NOB1 (NOB1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NOB1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: NOB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPTPKGGKYAINPHLTEDQRFPQLRLSQKARQKTNVFAPDYIAGVSPFVE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NOB1 Blocking Peptide, catalog no. 33R-5294, is also available for use as a blocking control in assays to test for specificity of this NOB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NOB1

Antigène: NOB1 (RNA-Binding Protein NOB1 (NOB1))

Autre désignation: NOB1 (NOB1 Produits)

Synonymes: anticorps MEE6.26, anticorps MEE6_26, anticorps Nob1p, anticorps fc27e05, anticorps si:ch73-167i17.3, anticorps wu:fc27e05, anticorps ART-4, anticorps MST158, anticorps NOB1P, anticorps PSMD8BP1, anticorps 1700021I09Rik, anticorps Psmd8bp1, anticorps NIN1/PSMD8 binding protein 1 homolog, anticorps RNA-binding NOB1-like protein, anticorps RNA-binding protein nob1, anticorps RNA-binding protein NOB1, anticorps NIN1/RPN12 binding protein 1 homolog S homeolog, anticorps NIN1/RPN12 binding protein 1 homolog (S. cerevisiae), anticorps NIN1/RPN12 binding protein 1 homolog, anticorps NOB1, anticorps AT5G41190, anticorps EDI_130960, anticorps CpipJ_CPIJ012739, anticorps BDBG_01281, anticorps PAAG_04204, anticorps PITG_13300, anticorps nob1.S, anticorps nob1, anticorps Nob1

Sujet: NOB1 may play a role in mRNA degradation.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus