RTDR1 anticorps (N-Term)
-
- Antigène Voir toutes RTDR1 Anticorps
- RTDR1 (Rhabdoid Tumor Deletion Region Gene 1 (RTDR1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RTDR1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RTDR1 antibody was raised against the N terminal of RTDR1
- Purification
- Affinity purified
- Immunogène
- RTDR1 antibody was raised using the N terminal of RTDR1 corresponding to a region with amino acids MAHSQNSLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMAL
- Top Product
- Discover our top product RTDR1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RTDR1 Blocking Peptide, catalog no. 33R-5675, is also available for use as a blocking control in assays to test for specificity of this RTDR1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTDR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RTDR1 (Rhabdoid Tumor Deletion Region Gene 1 (RTDR1))
- Autre désignation
- RTDR1 (RTDR1 Produits)
- Synonymes
- anticorps 4933431K05Rik, anticorps si:dkey-220o5.4, anticorps radial spoke head 14 homolog, anticorps rtdr1, putative, anticorps radial spoke head homolog 14 (Chlamydomonas), anticorps radial spoke head 14 homolog (Chlamydomonas), anticorps RSPH14, anticorps Smp_151730, anticorps Rsph14, anticorps rsph14
- Sujet
- The function of RTDR1 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 38 kDa (MW of target protein)
-