VPS26B anticorps

N° du produit ABIN632013

Détail du produit anti-VPS26B anticorps

Antigène: VPS26B (Vacuolar Protein Sorting 26 Homolog B (VPS26B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VPS26B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: VPS26 B antibody was raised using a synthetic peptide corresponding to a region with amino acids AGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VPS26B Blocking Peptide, catalog no. 33R-1235, is also available for use as a blocking control in assays to test for specificity of this VPS26B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VPS26B

Antigène: VPS26B (Vacuolar Protein Sorting 26 Homolog B (VPS26B))

Autre désignation: VPS26B (VPS26B Produits)

Synonymes: anticorps VPS26B, anticorps wu:fb49d07, anticorps wu:fb50d06, anticorps zgc:56297, anticorps pep8b, anticorps vps26b, anticorps Pep8b, anticorps VP26B, anticorps 1810012I05Rik, anticorps 2310075A12Rik, anticorps AI848392, anticorps T29A15.180, anticorps T29A15_180, anticorps vacuolar protein sorting 26B, anticorps vacuolar protein sorting 26 homolog B (S. pombe), anticorps VPS26, retromer complex component B, anticorps VPS26 retromer complex component B, anticorps VPS26 retromer complex component B S homeolog, anticorps vacuolar protein sorting 26B, anticorps VPS26B, anticorps vps26b, anticorps vps26b.S, anticorps Vps26b

Sujet: VPS26B belongs to the VPS26 family. VPS26B is probable component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process