AGAP2 anticorps (Middle Region)

N° du produit ABIN632064

Détail du produit anti-AGAP2 anticorps

Antigène: AGAP2 (ArfGAP with GTPase Domain, Ankyrin Repeat and PH Domain 2 (AGAP2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AGAP2 est non-conjugé

Application: Western Blotting (WB)

Specificité: CENTG1 antibody was raised against the middle region of CENTG1

Purification: Affinity purified

Immunogène: CENTG1 antibody was raised using the middle region of CENTG1 corresponding to a region with amino acids AHARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CENTG1 Blocking Peptide, catalog no. 33R-1240, is also available for use as a blocking control in assays to test for specificity of this CENTG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENTG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AGAP2

Antigène: AGAP2 (ArfGAP with GTPase Domain, Ankyrin Repeat and PH Domain 2 (AGAP2))

Autre désignation: CENTG1 (AGAP2 Produits)

Synonymes: anticorps zgc:153779, anticorps CENTG1, anticorps GGAP2, anticorps PIKE, anticorps Centg1, anticorps mKIAA0167, anticorps Pike, anticorps ArfGAP with GTPase domain, ankyrin repeat and PH domain 2, anticorps AGAP2, anticorps agap2, anticorps Agap2

Sujet: CENTG1 is a GTPase-activating protein (GAP) for ARF1 and ARF5, which also shows strong GTPase activity. Isoform 1 participates in the prevention of neuronal apoptosis by enhancing PI3 kinase activity. It aids the coupling of metabotropic glutamate receptor 1 (GRM1) to cytoplasmic PI3 kinase by interacting with Homer scaffolding proteins, and also seems to mediate anti-apoptotic effects of NGF by activating nuclear PI3 kinase. Isoform 2 does not stimulate PI3 kinase but may protect cells from apoptosis by stimulating Akt. It also regulates the adapter protein 1 (AP-1)-dependent trafficking of proteins in the endosomal system. It seems to be oncogenic. It is overexpressed in cancer cells, prevents apoptosis and promotes cancer cell invasion.

Poids moléculaire: 90 kDa (MW of target protein)