Casein Kinase 1 gamma 2 anticorps (N-Term)
-
- Antigène Voir toutes Casein Kinase 1 gamma 2 (CSNK1G2) Anticorps
- Casein Kinase 1 gamma 2 (CSNK1G2) (Casein Kinase 1, gamma 2 (CSNK1G2))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Casein Kinase 1 gamma 2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CK1 gamma 2 antibody was raised against the N terminal of CSNK1 G2
- Purification
- Affinity purified
- Immunogène
- CK1 gamma 2 antibody was raised using the N terminal of CSNK1 G2 corresponding to a region with amino acids FDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTK
- Top Product
- Discover our top product CSNK1G2 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CK1 gamma 2 Blocking Peptide, catalog no. 33R-2867, is also available for use as a blocking control in assays to test for specificity of this CK1 gamma 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Casein Kinase 1 gamma 2 (CSNK1G2) (Casein Kinase 1, gamma 2 (CSNK1G2))
- Abstract
- CSNK1G2 Produits
- Synonymes
- anticorps CK1g2, anticorps 2810429I12Rik, anticorps AI463719, anticorps CKI, anticorps ck1-gamma, anticorps CSNK1G2, anticorps ck1g2, anticorps csnk1g2, anticorps fj97g11, anticorps wu:fj97g11, anticorps wz8345, anticorps zgc:110719, anticorps zgc:153415, anticorps casein kinase 1 gamma 2, anticorps casein kinase 1, gamma 2, anticorps casein kinase 1 gamma 2 L homeolog, anticorps casein kinase 1, gamma 2a, anticorps casein kinase 1, gamma 2b, anticorps CSNK1G2, anticorps Csnk1g2, anticorps csnk1g2.L, anticorps csnk1g2, anticorps csnk1g2a, anticorps csnk1g2b
- Sujet
- CSNK1G2 belongs to the protein kinase superfamily, CK1 Ser/Thr protein kinase family, casein kinase I subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. It participates in Wnt signaling.
- Poids moléculaire
- 47 kDa (MW of target protein)
- Pathways
- Signalisation Hedgehog
-