PLEKHH2 anticorps
-
- Antigène Tous les produits PLEKHH2
- PLEKHH2 (Pleckstrin Homology Domain Containing, Family H (With MyTH4 Domain) Member 2 (PLEKHH2))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PLEKHH2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PLEKHH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGKYAIYCQRCVERTQ
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PLEKHH2 Blocking Peptide, catalog no. 33R-9995, is also available for use as a blocking control in assays to test for specificity of this PLEKHH2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLEKHH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PLEKHH2 (Pleckstrin Homology Domain Containing, Family H (With MyTH4 Domain) Member 2 (PLEKHH2))
- Autre désignation
- PLEKHH2 (PLEKHH2 Produits)
- Synonymes
- anticorps RGD1304935, anticorps si:ch73-105b23.3, anticorps PLEKHH1L, anticorps AI256725, anticorps E030001K05, anticorps mKIAA2028, anticorps pleckstrin homology, MyTH4 and FERM domain containing H2, anticorps pleckstrin homology domain containing, family H (with MyTH4 domain) member 2, anticorps Plekhh2, anticorps plekhh2, anticorps PLEKHH2
- Sujet
- PLEKHH2 contains 1 FERM domain, 1 MyTH4 domain and 2 PH domains. It is a single-pass membrane protein. The exact function of PLEKHH2 remains unknown.
- Poids moléculaire
- 168 kDa (MW of target protein)
-