CES2 anticorps

N° du produit ABIN632102

Détail du produit anti-CES2 anticorps

Antigène: CES2 (Carboxylesterase 2 (CES2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CES2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Carboxylesterase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERH

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Carboxylesterase 2 Blocking Peptide, catalog no. 33R-3874, is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CES2

Antigène: CES2 (Carboxylesterase 2 (CES2))

Autre désignation: Carboxylesterase 2 (CES2 Produits)

Synonymes: anticorps CE-2, anticorps CES2A1, anticorps PCE-2, anticorps iCE, anticorps Ces2, anticorps im:6908784, anticorps si:dkey-38l12.2, anticorps zgc:153863, anticorps ce-2, anticorps ces2a1, anticorps pce-2, anticorps carboxylesterase 2, anticorps liver carboxylesterase 2, anticorps cocaine esterase, anticorps carboxylesterase 2 (intestine, liver), anticorps CES2, anticorps Ces2, anticorps LOC100343300, anticorps LOC100734360, anticorps ces2

Sujet: Carboxylesterase 2 is a member of a large multigene family. The enzymes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined, however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system.

Poids moléculaire: 69 kDa (MW of target protein)