CES2 anticorps
-
- Antigène Voir toutes CES2 Anticorps
- CES2 (Carboxylesterase 2 (CES2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CES2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Carboxylesterase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERH
- Top Product
- Discover our top product CES2 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Carboxylesterase 2 Blocking Peptide, catalog no. 33R-3874, is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CES2 (Carboxylesterase 2 (CES2))
- Autre désignation
- Carboxylesterase 2 (CES2 Produits)
- Synonymes
- anticorps CE-2, anticorps CES2A1, anticorps PCE-2, anticorps iCE, anticorps Ces2, anticorps im:6908784, anticorps si:dkey-38l12.2, anticorps zgc:153863, anticorps ce-2, anticorps ces2a1, anticorps pce-2, anticorps carboxylesterase 2, anticorps liver carboxylesterase 2, anticorps cocaine esterase, anticorps carboxylesterase 2 (intestine, liver), anticorps CES2, anticorps Ces2, anticorps LOC100343300, anticorps LOC100734360, anticorps ces2
- Sujet
- Carboxylesterase 2 is a member of a large multigene family. The enzymes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined, however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system.
- Poids moléculaire
- 69 kDa (MW of target protein)
-