COPS4 anticorps

N° du produit ABIN632182

Détail du produit anti-COPS4 anticorps

Antigène: COPS4 (COP9 Signalosome Subunit 4 (COPS4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COPS4 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: COPS4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

COPS4 Blocking Peptide, catalog no. 33R-10150, is also available for use as a blocking control in assays to test for specificity of this COPS4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPS4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COPS4

Antigène: COPS4 (COP9 Signalosome Subunit 4 (COPS4))

Autre désignation: COPS4 (COPS4 Produits)

Synonymes: anticorps CG8725, anticorps CH4, anticorps Cops4, anticorps Csn4, anticorps DCH4, anticorps Dch4, anticorps Dmel\\CG8725, anticorps csn4, anticorps l(2)k08018, anticorps COPS4, anticorps SGN4, anticorps DKFZp459H0324, anticorps AW208976, anticorps D5Ertd774e, anticorps fc90c08, anticorps wu:fc90c08, anticorps zgc:77137, anticorps ATS4, anticorps CONSTITUTIVE PHOTOMORPHOGENIC 14, anticorps CONSTITUTIVE PHOTOMORPHOGENIC 8, anticorps COP14, anticorps COP9 SIGNALOSOME SUBUNIT 4, anticorps CSN4, anticorps EMB134, anticorps EMBRYO DEFECTIVE 134, anticorps FUS4, anticorps FUS8, anticorps FUSCA 4, anticorps FUSCA 8, anticorps MBD2.17, anticorps MBD2_17, anticorps COS41.8, anticorps COP9 signalosome subunit 4, anticorps COP9 signalosome complex subunit 4, anticorps COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis), anticorps Proteasome component (PCI) domain protein, anticorps COP9 signalosome subunit 4 L homeolog, anticorps CSN4, anticorps COPS4, anticorps CpipJ_CPIJ000966, anticorps csn4, anticorps Cops4, anticorps cops4, anticorps COP8, anticorps cops4.L, anticorps csn-4

Sujet: COPS4 is one of eight subunits composing COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases.

Poids moléculaire: 46 kDa (MW of target protein)

Pathways: Cycle Cellulaire