Carabin anticorps (N-Term)
-
- Antigène Voir toutes Carabin (TBC1D10C) Anticorps
- Carabin (TBC1D10C) (TBC1 Domain Family, Member 10C (TBC1D10C))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Carabin est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TBC1 D11 antibody was raised against the N terminal of TBC1 11
- Purification
- Affinity purified
- Immunogène
- TBC1 D11 antibody was raised using the N terminal of TBC1 11 corresponding to a region with amino acids MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEP
- Top Product
- Discover our top product TBC1D10C Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TBC1D10C Blocking Peptide, catalog no. 33R-5722, is also available for use as a blocking control in assays to test for specificity of this TBC1D10C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Carabin (TBC1D10C) (TBC1 Domain Family, Member 10C (TBC1D10C))
- Autre désignation
- TBC1D10C (TBC1D10C Produits)
- Synonymes
- anticorps CARABIN, anticorps EPI64C, anticorps 1810062O14Rik, anticorps AI428527, anticorps RGD1311490, anticorps TBC1 domain family member 10C, anticorps TBC1 domain family, member 10c, anticorps TBC1 domain family, member 10C, anticorps TBC1D10C, anticorps Tbc1d10c
- Sujet
- TBC1D10C inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein (GAP) activity. TBC1D10C acts as a negative feedback inhibitor of the calcineurin signaling pathway that also mediates crosstalk between calcineurin and Ras.Carabin is an endogenous inhibitor of calcineurin that also inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein activity.
- Poids moléculaire
- 50 kDa (MW of target protein)
-