Carabin anticorps (N-Term)

N° du produit ABIN632187

Cet anticorps anti-Carabin Polyclonal Lapin (ABIN632187) détecte spécifiquement Carabin dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour Carabin anticorps (N-Term) (ABIN632187)

Antigène: Carabin (TBC1D10C) (TBC1 Domain Family, Member 10C (TBC1D10C))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Carabin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Carabin anticorps

Épitope: N-Term

Specificité: TBC1 D11 antibody was raised against the N terminal of TBC1 11

Purification: Affinity purified

Immunogène: TBC1 D11 antibody was raised using the N terminal of TBC1 11 corresponding to a region with amino acids MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TBC1D10C Blocking Peptide, (ABIN5616511), is also available for use as a blocking control in assays to test for specificity of this TBC1D10C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Carabin

Antigène: Carabin (TBC1D10C) (TBC1 Domain Family, Member 10C (TBC1D10C))

Autre désignation: TBC1D10C

Sujet: TBC1D10C inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein (GAP) activity. TBC1D10C acts as a negative feedback inhibitor of the calcineurin signaling pathway that also mediates crosstalk between calcineurin and Ras.Carabin is an endogenous inhibitor of calcineurin that also inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein activity.

Poids moléculaire: 50 kDa (MW of target protein)