14-3-3 zeta anticorps (Middle Region)
-
- Antigène Voir toutes 14-3-3 zeta (YWHAZ) Anticorps
- 14-3-3 zeta (YWHAZ)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp 14-3-3 zeta est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- YWHAZ antibody was raised against the middle region of Ywhaz
- Purification
- Affinity purified
- Immunogène
- YWHAZ antibody was raised using the middle region of Ywhaz corresponding to a region with amino acids FDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
- Top Product
- Discover our top product YWHAZ Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
YWHAZ Blocking Peptide, catalog no. 33R-2862, is also available for use as a blocking control in assays to test for specificity of this YWHAZ antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YWHAZ antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- 14-3-3 zeta (YWHAZ)
- Autre désignation
- YWHAZ (YWHAZ Produits)
- Synonymes
- anticorps 14-3-3-zeta, anticorps KCIP-1, anticorps YWHAD, anticorps 14-3-3zeta, anticorps Ywhaz, anticorps ACYPI003154, anticorps 14-3-3z, anticorps kcip-1, anticorps ywhaq, anticorps 1433z, anticorps ywhaz, anticorps ywhazb, anticorps 1110013I11Rik, anticorps AI596267, anticorps AL022924, anticorps AU020854, anticorps ywhaza, anticorps fb14h09, anticorps wu:fb05g08, anticorps wu:fb14h09, anticorps ywhai, anticorps zgc:55807, anticorps 14-3-3, anticorps 14-3-3 zeta, anticorps 14-3-3ZETA, anticorps 14-3-3leo, anticorps 2G1, anticorps 4-3-3 zeta, anticorps 5.11, anticorps 549, anticorps BEST:GH05075, anticorps CG17870, anticorps D14-3-3, anticorps D14-3-3zeta, anticorps Dmel\\CG17870, anticorps K, anticorps LEO, anticorps Leo, anticorps PAR-5, anticorps PAR5, anticorps Par-5, anticorps d14-3-3zeta, anticorps l(2)07103, anticorps l(2)46CFe, anticorps l(2)46Ee, anticorps leo, anticorps par-5, anticorps tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta, anticorps 14-3-3 protein zeta, anticorps tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta L homeolog, anticorps tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide, anticorps tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta, anticorps tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta S homeolog, anticorps 14-3-3 protein zeta/delta pseudogene, anticorps CG17870 gene product from transcript CG17870-RE, anticorps YWHAZ, anticorps 14-3-3zeta, anticorps ywhaz, anticorps 1433z, anticorps ywhaz.L, anticorps Ywhaz, anticorps ywhaz.S, anticorps LOC100855903
- Sujet
- YWHAZ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins.
- Poids moléculaire
- 28 kDa (MW of target protein)
- Pathways
- Apoptose, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location
-