Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

14-3-3 zeta anticorps (Middle Region)

YWHAZ Reactivité: Humain, Souris, Rat WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN632205
  • Antigène Voir toutes 14-3-3 zeta (YWHAZ) Anticorps
    14-3-3 zeta (YWHAZ)
    Épitope
    • 29
    • 17
    • 13
    • 8
    • 8
    • 7
    • 7
    • 7
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Middle Region
    Reactivité
    • 135
    • 85
    • 69
    • 11
    • 10
    • 8
    • 8
    • 7
    • 5
    • 5
    • 4
    • 4
    • 3
    • 2
    • 1
    • 1
    • 1
    Humain, Souris, Rat
    Hôte
    • 128
    • 7
    Lapin
    Clonalité
    • 129
    • 6
    Polyclonal
    Conjugué
    • 70
    • 10
    • 7
    • 6
    • 5
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    Cet anticorp 14-3-3 zeta est non-conjugé
    Application
    • 116
    • 58
    • 53
    • 30
    • 27
    • 22
    • 13
    • 13
    • 10
    • 7
    • 4
    • 3
    • 2
    • 1
    Western Blotting (WB)
    Specificité
    YWHAZ antibody was raised against the middle region of Ywhaz
    Purification
    Affinity purified
    Immunogène
    YWHAZ antibody was raised using the middle region of Ywhaz corresponding to a region with amino acids FDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
    Top Product
    Discover our top product YWHAZ Anticorps primaire
  • Indications d'application
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Commentaires

    YWHAZ Blocking Peptide, catalog no. 33R-2862, is also available for use as a blocking control in assays to test for specificity of this YWHAZ antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YWHAZ antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Conseil sur la manipulation
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Antigène
    14-3-3 zeta (YWHAZ)
    Autre désignation
    YWHAZ (YWHAZ Produits)
    Synonymes
    anticorps 14-3-3-zeta, anticorps KCIP-1, anticorps YWHAD, anticorps 14-3-3zeta, anticorps Ywhaz, anticorps ACYPI003154, anticorps 14-3-3z, anticorps kcip-1, anticorps ywhaq, anticorps 1433z, anticorps ywhaz, anticorps ywhazb, anticorps 1110013I11Rik, anticorps AI596267, anticorps AL022924, anticorps AU020854, anticorps ywhaza, anticorps fb14h09, anticorps wu:fb05g08, anticorps wu:fb14h09, anticorps ywhai, anticorps zgc:55807, anticorps 14-3-3, anticorps 14-3-3 zeta, anticorps 14-3-3ZETA, anticorps 14-3-3leo, anticorps 2G1, anticorps 4-3-3 zeta, anticorps 5.11, anticorps 549, anticorps BEST:GH05075, anticorps CG17870, anticorps D14-3-3, anticorps D14-3-3zeta, anticorps Dmel\\CG17870, anticorps K, anticorps LEO, anticorps Leo, anticorps PAR-5, anticorps PAR5, anticorps Par-5, anticorps d14-3-3zeta, anticorps l(2)07103, anticorps l(2)46CFe, anticorps l(2)46Ee, anticorps leo, anticorps par-5, anticorps tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta, anticorps 14-3-3 protein zeta, anticorps tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta L homeolog, anticorps tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide, anticorps tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta, anticorps tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta S homeolog, anticorps 14-3-3 protein zeta/delta pseudogene, anticorps CG17870 gene product from transcript CG17870-RE, anticorps YWHAZ, anticorps 14-3-3zeta, anticorps ywhaz, anticorps 1433z, anticorps ywhaz.L, anticorps Ywhaz, anticorps ywhaz.S, anticorps LOC100855903
    Sujet
    YWHAZ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins.
    Poids moléculaire
    28 kDa (MW of target protein)
    Pathways
    Apoptose, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location
Vous êtes ici:
Support technique