EBI3 anticorps (Middle Region)

N° du produit ABIN632221

Détail du produit anti-EBI3 anticorps

Antigène: EBI3 (IL-27b) (Interleukin-27 subunit beta (IL-27b))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EBI3 est non-conjugé

Application: Western Blotting (WB)

Specificité: EBI3 antibody was raised against the middle region of EBI3

Purification: Affinity purified

Immunogène: EBI3 antibody was raised using the middle region of EBI3 corresponding to a region with amino acids TAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EBI3 Blocking Peptide, catalog no. 33R-8990, is also available for use as a blocking control in assays to test for specificity of this EBI3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EBI3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EBI3

Antigène: EBI3 (IL-27b) (Interleukin-27 subunit beta (IL-27b))

Autre désignation: EBI3 (IL-27b Produits)

Synonymes: anticorps IL-27B, anticorps IL27B, anticorps EBI3, anticorps il-27rb, anticorps si:dkey-97a13.4, anticorps EBI-3, anticorps IL-27, anticorps Epstein-Barr virus induced 3, anticorps Epstein-Barr virus induced gene 3, anticorps EBI3, anticorps ebi3, anticorps Ebi3

Classe de substances: Viral Protein

Sujet: This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells.

Poids moléculaire: 23 kDa (MW of target protein)