Fgr anticorps
-
- Antigène Voir toutes Fgr (FGR) Anticorps
- Fgr (FGR) (Gardner-Rasheed Feline Sarcoma Viral (V-Fgr) Oncogene Homolog (FGR))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Fgr est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- FGR antibody was raised using a synthetic peptide corresponding to a region with amino acids CPPGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQ
- Top Product
- Discover our top product FGR Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FGR Blocking Peptide, catalog no. 33R-1770, is also available for use as a blocking control in assays to test for specificity of this FGR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Fgr (FGR) (Gardner-Rasheed Feline Sarcoma Viral (V-Fgr) Oncogene Homolog (FGR))
- Autre désignation
- FGR (FGR Produits)
- Synonymes
- anticorps SRC2, anticorps c-fgr, anticorps c-src2, anticorps p55-Fgr, anticorps p55c-fgr, anticorps p58-Fgr, anticorps p58c-fgr, anticorps FGR proto-oncogene, Src family tyrosine kinase, anticorps FGR, anticorps Fgr
- Sujet
- This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively.
- Poids moléculaire
- 59 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound, Stem Cell Maintenance, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling
-