Fgr anticorps

N° du produit ABIN632228

L’anticorps anti-Fgr Polyclonal Lapin est utilisé pour la détection de Fgr dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour Fgr anticorps (ABIN632228)

Antigène: Fgr (FGR) (Gardner-Rasheed Feline Sarcoma Viral (V-Fgr) Oncogene Homolog (FGR))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Fgr est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Fgr anticorps

Purification: Affinity purified

Immunogène: FGR antibody was raised using a synthetic peptide corresponding to a region with amino acids CPPGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FGR Blocking Peptide, (ABIN937156), is also available for use as a blocking control in assays to test for specificity of this FGR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Fgr

Antigène: Fgr (FGR) (Gardner-Rasheed Feline Sarcoma Viral (V-Fgr) Oncogene Homolog (FGR))

Autre désignation: FGR

Sujet: This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively.

Poids moléculaire: 59 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Stem Cell Maintenance, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling