EPS8 anticorps (Middle Region)

N° du produit ABIN632256

Détail du produit anti-EPS8 anticorps

Antigène: EPS8 (Epidermal Growth Factor Receptor Pathway Substrate 8 (EPS8))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EPS8 est non-conjugé

Application: Western Blotting (WB)

Specificité: EPS8 antibody was raised against the middle region of EPS8

Purification: Affinity purified

Immunogène: EPS8 antibody was raised using the middle region of EPS8 corresponding to a region with amino acids VSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EPS8 Blocking Peptide, catalog no. 33R-9810, is also available for use as a blocking control in assays to test for specificity of this EPS8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPS8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EPS8

Antigène: EPS8 (Epidermal Growth Factor Receptor Pathway Substrate 8 (EPS8))

Autre désignation: EPS8 (EPS8 Produits)

Synonymes: anticorps AW261790, anticorps MGC81285, anticorps MGC146320, anticorps zgc:56041, anticorps epidermal growth factor receptor pathway substrate 8, anticorps epidermal growth factor receptor pathway substrate 8 L homeolog, anticorps EPS8, anticorps Eps8, anticorps eps8.L, anticorps eps8

Sujet: This gene encodes a member of the EPS8 family. This protein contains one PH domain and one SH3 domain. It functions as part of the EGFR pathway, though its exact role has not been determined.

Poids moléculaire: 92 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Regulation of Actin Filament Polymerization