SAMD4A anticorps (Middle Region)
-
- Antigène Voir toutes SAMD4A Anticorps
- SAMD4A (Sterile alpha Motif Domain Containing 4A (SAMD4A))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SAMD4A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SAMD4 A antibody was raised against the middle region of SAMD4
- Purification
- Affinity purified
- Immunogène
- SAMD4 A antibody was raised using the middle region of SAMD4 corresponding to a region with amino acids LKSLRLHKYAALFSQMTYEEMMALTECQLEAQNVTKGARHKIVISIQKLK
- Top Product
- Discover our top product SAMD4A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SAMD4A Blocking Peptide, catalog no. 33R-5106, is also available for use as a blocking control in assays to test for specificity of this SAMD4A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAMD0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SAMD4A (Sterile alpha Motif Domain Containing 4A (SAMD4A))
- Autre désignation
- SAMD4A (SAMD4A Produits)
- Synonymes
- anticorps SAMD4, anticorps SMAUG, anticorps SMAUG1, anticorps SMG, anticorps SMGA, anticorps Samd4, anticorps smaug1, anticorps sterile alpha motif domain containing 4A, anticorps sterile alpha motif domain containing 4A S homeolog, anticorps SAMD4A, anticorps Samd4a, anticorps samd4a.S, anticorps samd4a
- Sujet
- Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an RNA-binding domain that functions as a posttranscriptional regulator by binding to an RNA sequence motif known as the Smaug recognition element, which was named after the Drosophila Smaug protein.
- Poids moléculaire
- 79 kDa (MW of target protein)
-