SAMD4A anticorps (Middle Region)

N° du produit ABIN632312

Détail du produit anti-SAMD4A anticorps

Antigène: SAMD4A (Sterile alpha Motif Domain Containing 4A (SAMD4A))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SAMD4A est non-conjugé

Application: Western Blotting (WB)

Specificité: SAMD4 A antibody was raised against the middle region of SAMD4

Purification: Affinity purified

Immunogène: SAMD4 A antibody was raised using the middle region of SAMD4 corresponding to a region with amino acids LKSLRLHKYAALFSQMTYEEMMALTECQLEAQNVTKGARHKIVISIQKLK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SAMD4A Blocking Peptide, catalog no. 33R-5106, is also available for use as a blocking control in assays to test for specificity of this SAMD4A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAMD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SAMD4A

Antigène: SAMD4A (Sterile alpha Motif Domain Containing 4A (SAMD4A))

Autre désignation: SAMD4A (SAMD4A Produits)

Synonymes: anticorps SAMD4, anticorps SMAUG, anticorps SMAUG1, anticorps SMG, anticorps SMGA, anticorps Samd4, anticorps smaug1, anticorps sterile alpha motif domain containing 4A, anticorps sterile alpha motif domain containing 4A S homeolog, anticorps SAMD4A, anticorps Samd4a, anticorps samd4a.S, anticorps samd4a

Sujet: Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an RNA-binding domain that functions as a posttranscriptional regulator by binding to an RNA sequence motif known as the Smaug recognition element, which was named after the Drosophila Smaug protein.

Poids moléculaire: 79 kDa (MW of target protein)