PDHB anticorps

N° du produit ABIN632317

Détail du produit anti-PDHB anticorps

Antigène: PDHB (Pyruvate Dehydrogenase beta (PDHB))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDHB est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PDHB antibody was raised using a synthetic peptide corresponding to a region with amino acids GLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAID

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDHB Blocking Peptide, catalog no. 33R-3431, is also available for use as a blocking control in assays to test for specificity of this PDHB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDHB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDHB

Antigène: PDHB (Pyruvate Dehydrogenase beta (PDHB))

Autre désignation: PDHB (PDHB Produits)

Synonymes: anticorps CG 11876, anticorps Dmel\\CG11876, anticorps E1beta, anticorps PDHB, anticorps zgc:64062, anticorps wu:fc76a05, anticorps PDHBD, anticorps PDHE1-B, anticorps PHE1B, anticorps 2610103L06Rik, anticorps AL024199, anticorps C81408, anticorps CG11876 gene product from transcript CG11876-RA, anticorps pyruvate dehydrogenase E1 beta subunit, anticorps pyruvate dehydrogenase (lipoamide) beta, anticorps CG11876, anticorps pdhb, anticorps PDHB, anticorps Pdhb

Sujet: The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2. It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: L'effet Warburg