PDHB anticorps

N° du produit ABIN632317

Cet anticorps Lapin Polyclonal détecte spécifiquement PDHB dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PDHB anticorps (ABIN632317)

Antigène: PDHB (Pyruvate Dehydrogenase beta (PDHB))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDHB est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PDHB anticorps

Purification: Affinity purified

Immunogène: PDHB antibody was raised using a synthetic peptide corresponding to a region with amino acids GLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAID

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDHB Blocking Peptide, (ABIN938817), is also available for use as a blocking control in assays to test for specificity of this PDHB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDHB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDHB

Antigène: PDHB (Pyruvate Dehydrogenase beta (PDHB))

Autre désignation: PDHB

Sujet: The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2. It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: L'effet Warburg