PYCR2 anticorps (Middle Region)

N° du produit ABIN632328

Détail du produit anti-PYCR2 anticorps

Antigène: PYCR2 (Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PYCR2 est non-conjugé

Application: Western Blotting (WB)

Specificité: PYCR2 antibody was raised against the middle region of PYCR2

Purification: Affinity purified

Immunogène: PYCR2 antibody was raised using the middle region of PYCR2 corresponding to a region with amino acids LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PYCR2 Blocking Peptide, catalog no. 33R-4866, is also available for use as a blocking control in assays to test for specificity of this PYCR2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYCR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PYCR2

Antigène: PYCR2 (Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2))

Autre désignation: PYCR2 (PYCR2 Produits)

Synonymes: anticorps p5c, anticorps p5cr, anticorps pro3, anticorps pycr, anticorps pig45, anticorps pp222, anticorps pycr2, anticorps arcl2b, anticorps P5CR2, anticorps 1810018M05Rik, anticorps P5cr2, anticorps pyrroline-5-carboxylate reductase 2, anticorps pyrroline-5-carboxylate reductase family, member 1, anticorps pyrroline-5-carboxylate reductase 1, anticorps pyrroline-5-carboxylate reductase family, member 2, anticorps pyrroline-5-carboxylate reductase 1b, anticorps PYCR2, anticorps pycr1, anticorps PYCR1, anticorps Pycr2, anticorps pycr1b

Sujet: PYCR2 belongs to the pyrroline-5-carboxylate reductase family. The function of the PYCR2 protein is not known.

Poids moléculaire: 34 kDa (MW of target protein)