PYCR2 anticorps (Middle Region)
-
- Antigène Voir toutes PYCR2 Anticorps
- PYCR2 (Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PYCR2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PYCR2 antibody was raised against the middle region of PYCR2
- Purification
- Affinity purified
- Immunogène
- PYCR2 antibody was raised using the middle region of PYCR2 corresponding to a region with amino acids LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRE
- Top Product
- Discover our top product PYCR2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PYCR2 Blocking Peptide, catalog no. 33R-4866, is also available for use as a blocking control in assays to test for specificity of this PYCR2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYCR2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PYCR2 (Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2))
- Autre désignation
- PYCR2 (PYCR2 Produits)
- Synonymes
- anticorps p5c, anticorps p5cr, anticorps pro3, anticorps pycr, anticorps pig45, anticorps pp222, anticorps pycr2, anticorps arcl2b, anticorps P5CR2, anticorps 1810018M05Rik, anticorps P5cr2, anticorps pyrroline-5-carboxylate reductase 2, anticorps pyrroline-5-carboxylate reductase family, member 1, anticorps pyrroline-5-carboxylate reductase 1, anticorps pyrroline-5-carboxylate reductase family, member 2, anticorps pyrroline-5-carboxylate reductase 1b, anticorps PYCR2, anticorps pycr1, anticorps PYCR1, anticorps Pycr2, anticorps pycr1b
- Sujet
- PYCR2 belongs to the pyrroline-5-carboxylate reductase family. The function of the PYCR2 protein is not known.
- Poids moléculaire
- 34 kDa (MW of target protein)
-