USP12 anticorps (Middle Region)

N° du produit ABIN632371

Détail du produit anti-USP12 anticorps

Antigène: USP12 (Ubiquitin Specific Peptidase 12 (USP12))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp USP12 est non-conjugé

Application: Western Blotting (WB)

Specificité: USP12 antibody was raised against the middle region of USP12

Purification: Affinity purified

Immunogène: USP12 antibody was raised using the middle region of USP12 corresponding to a region with amino acids ITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

USP12 Blocking Peptide, catalog no. 33R-4187, is also available for use as a blocking control in assays to test for specificity of this USP12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur USP12

Antigène: USP12 (Ubiquitin Specific Peptidase 12 (USP12))

Autre désignation: USP12 (USP12 Produits)

Synonymes: anticorps UBH1, anticorps USP12L1, anticorps usp12, anticorps USP12P1, anticorps sb:eu882, anticorps wu:fi09d12, anticorps Ubh1, anticorps ubh1, anticorps usp12l1, anticorps ubiquitin specific peptidase 12, anticorps ubiquitin specific peptidase 12a, anticorps ubiquitin specific peptidase 12 L homeolog, anticorps ubiquitin specific peptidase 12 S homeolog, anticorps USP12, anticorps usp12, anticorps Usp12, anticorps usp12a, anticorps usp12.L, anticorps usp12.S

Sujet: USP12 is a deubiquitinating enzyme. USP12 has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. USP12 is not involved in deubiquitination of monoubiquitinated FANCD2.

Poids moléculaire: 43 kDa (MW of target protein)