USP12 anticorps (Middle Region)

N° du produit ABIN632371

Cet anticorps Lapin Polyclonal détecte spécifiquement USP12 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour USP12 anticorps (Middle Region) (ABIN632371)

Antigène: USP12 (Ubiquitin Specific Peptidase 12 (USP12))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp USP12 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-USP12 anticorps

Épitope: Middle Region

Specificité: USP12 antibody was raised against the middle region of USP12

Purification: Affinity purified

Immunogène: USP12 antibody was raised using the middle region of USP12 corresponding to a region with amino acids ITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

USP12 Blocking Peptide, (ABIN939573), is also available for use as a blocking control in assays to test for specificity of this USP12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur USP12

Antigène: USP12 (Ubiquitin Specific Peptidase 12 (USP12))

Autre désignation: USP12

Sujet: USP12 is a deubiquitinating enzyme. USP12 has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. USP12 is not involved in deubiquitination of monoubiquitinated FANCD2.

Poids moléculaire: 43 kDa (MW of target protein)