PPIH anticorps

N° du produit ABIN632391

Détail du produit anti-PPIH anticorps

Antigène: PPIH (Peptidylprolyl Isomerase H (Cyclophilin H) (PPIH))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPIH est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PPIH antibody was raised using a synthetic peptide corresponding to a region with amino acids DFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPIH Blocking Peptide, catalog no. 33R-1933, is also available for use as a blocking control in assays to test for specificity of this PPIH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPIH

Antigène: PPIH (Peptidylprolyl Isomerase H (Cyclophilin H) (PPIH))

Autre désignation: PPIH (PPIH Produits)

Synonymes: anticorps CYP-20, anticorps CYPH, anticorps SnuCyp-20, anticorps USA-CYP, anticorps RGD1564921, anticorps cyp-20, anticorps cyph, anticorps snucyp-20, anticorps usa-cyp, anticorps PPIH, anticorps zgc:136730, anticorps zgc:158595, anticorps zgc:55766, anticorps zgc:86780, anticorps 1100001J08Rik, anticorps 2010111B15Rik, anticorps 4833408F11Rik, anticorps AI464484, anticorps D4Wsu43e, anticorps peptidylprolyl isomerase H, anticorps peptidylprolyl isomerase H (cyclophilin H), anticorps peptidylprolyl isomerase H L homeolog, anticorps peptidyl prolyl isomerase H, anticorps PPIH, anticorps Ppih, anticorps ppih, anticorps ppih.L

Sujet: The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome.

Poids moléculaire: 19 kDa (MW of target protein)