OSGEP anticorps (Middle Region)
-
- Antigène Voir toutes OSGEP Anticorps
- OSGEP (O-Sialoglycoprotein Endopeptidase (OSGEP))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp OSGEP est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- OSGEP antibody was raised against the middle region of OSGEP
- Purification
- Affinity purified
- Immunogène
- OSGEP antibody was raised using the middle region of OSGEP corresponding to a region with amino acids EHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVE
- Top Product
- Discover our top product OSGEP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
OSGEP Blocking Peptide, catalog no. 33R-2460, is also available for use as a blocking control in assays to test for specificity of this OSGEP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSGEP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- OSGEP (O-Sialoglycoprotein Endopeptidase (OSGEP))
- Autre désignation
- OSGEP (OSGEP Produits)
- Synonymes
- anticorps MGC64557, anticorps wu:fj38e02, anticorps zgc:112527, anticorps si:ch211-214j24.11, anticorps Afu6g04510, anticorps Tb07.33N13.430, anticorps GCPL1, anticorps KAE1, anticorps OSGEP1, anticorps PRSMG1, anticorps 1500019L24Rik, anticorps GCPL-1, anticorps O-sialoglycoprotein endopeptidase L homeolog, anticorps O-sialoglycoprotein endopeptidase, anticorps o-sialoglycoprotein endopeptidase, anticorps osgep.L, anticorps OSGEP, anticorps osgep, anticorps CNA03390, anticorps AFUA_6G04510, anticorps Tc00.1047053508913.39, anticorps Tc00.1047053506515.20, anticorps Tb927.7.6470, anticorps PVX_111195, anticorps AaeL_AAEL001942, anticorps GL50803_17420, anticorps EDI_342200, anticorps CC1G_03622, anticorps THAPSDRAFT_2332, anticorps TTHERM_00442549, anticorps Osgep, anticorps LOC100273984
- Sujet
- O-sialoglycoprotein endopeptidases specifically cleave the polypeptide backbone of membrane glycoproteins that contain clusters of O-linked sialoglycans.
- Poids moléculaire
- 36 kDa (MW of target protein)
-