EIF2B1 anticorps (C-Term)

N° du produit ABIN632422

Détail du produit anti-EIF2B1 anticorps

Antigène: EIF2B1 (Eukaryotic Translation Initiation Factor 2B, Subunit 1 Alpha, 26kDa (EIF2B1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF2B1 est non-conjugé

Application: Western Blotting (WB)

Specificité: EIF2 B1 antibody was raised against the C terminal of EIF2 1

Purification: Affinity purified

Immunogène: EIF2 B1 antibody was raised using the C terminal of EIF2 1 corresponding to a region with amino acids ADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF2B1 Blocking Peptide, catalog no. 33R-1107, is also available for use as a blocking control in assays to test for specificity of this EIF2B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF2B1

Antigène: EIF2B1 (Eukaryotic Translation Initiation Factor 2B, Subunit 1 Alpha, 26kDa (EIF2B1))

Autre désignation: EIF2B1 (EIF2B1 Produits)

Synonymes: anticorps DDBDRAFT_0219393, anticorps DDBDRAFT_0231375, anticorps DDB_0219393, anticorps DDB_0231375, anticorps 26kDa, anticorps D5Ertd406e, anticorps EIF2B, anticorps EIF2BA, anticorps eIF-2a, anticorps translation initiation factor eIF-2B alpha subunit, anticorps hypothetical protein, anticorps Translation initiation factor eIF-2B subunit alpha, anticorps eukaryotic translation initiation factor 2B subunit alpha, anticorps eukaryotic translation initiation factor 2B, subunit 1 (alpha), anticorps eIF2b1, anticorps PGTG_05021, anticorps ei2ba, anticorps eif2b1, anticorps Eif2b1, anticorps EIF2B1

Sujet: EIF2B1 belongs to the EIF-2B alpha/beta/delta subunits family. It catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. Defects in EIF2B1 are a cause of leukoencephalopathy with vanishing white matter (VWM).

Poids moléculaire: 34 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process