EIF2B1 anticorps (C-Term)
-
- Antigène Voir toutes EIF2B1 Anticorps
- EIF2B1 (Eukaryotic Translation Initiation Factor 2B, Subunit 1 Alpha, 26kDa (EIF2B1))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EIF2B1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EIF2 B1 antibody was raised against the C terminal of EIF2 1
- Purification
- Affinity purified
- Immunogène
- EIF2 B1 antibody was raised using the C terminal of EIF2 1 corresponding to a region with amino acids ADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKL
- Top Product
- Discover our top product EIF2B1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EIF2B1 Blocking Peptide, catalog no. 33R-1107, is also available for use as a blocking control in assays to test for specificity of this EIF2B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EIF2B1 (Eukaryotic Translation Initiation Factor 2B, Subunit 1 Alpha, 26kDa (EIF2B1))
- Autre désignation
- EIF2B1 (EIF2B1 Produits)
- Synonymes
- anticorps DDBDRAFT_0219393, anticorps DDBDRAFT_0231375, anticorps DDB_0219393, anticorps DDB_0231375, anticorps 26kDa, anticorps D5Ertd406e, anticorps EIF2B, anticorps EIF2BA, anticorps eIF-2a, anticorps translation initiation factor eIF-2B alpha subunit, anticorps hypothetical protein, anticorps Translation initiation factor eIF-2B subunit alpha, anticorps eukaryotic translation initiation factor 2B subunit alpha, anticorps eukaryotic translation initiation factor 2B, subunit 1 (alpha), anticorps eIF2b1, anticorps PGTG_05021, anticorps ei2ba, anticorps eif2b1, anticorps Eif2b1, anticorps EIF2B1
- Sujet
- EIF2B1 belongs to the EIF-2B alpha/beta/delta subunits family. It catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. Defects in EIF2B1 are a cause of leukoencephalopathy with vanishing white matter (VWM).
- Poids moléculaire
- 34 kDa (MW of target protein)
- Pathways
- Methionine Biosynthetic Process
-