GLOD4 anticorps (Middle Region)
-
- Antigène Voir toutes GLOD4 Anticorps
- GLOD4 (Glyoxalase Domain Containing 4 (GLOD4))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GLOD4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GLOD4 antibody was raised against the middle region of GLOD4
- Purification
- Affinity purified
- Immunogène
- GLOD4 antibody was raised using the middle region of GLOD4 corresponding to a region with amino acids LAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGG
- Top Product
- Discover our top product GLOD4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GLOD4 Blocking Peptide, catalog no. 33R-4809, is also available for use as a blocking control in assays to test for specificity of this GLOD4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLOD4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GLOD4 (Glyoxalase Domain Containing 4 (GLOD4))
- Autre désignation
- GLOD4 (GLOD4 Produits)
- Synonymes
- anticorps MGC76089, anticorps MGC84515, anticorps wu:fj45g03, anticorps zgc:103490, anticorps C17orf25, anticorps HC71, anticorps 1700082G03Rik, anticorps 2700085E05Rik, anticorps C81254, anticorps RGD1307010, anticorps glyoxalase domain containing 4, anticorps glyoxalase domain containing 4 L homeolog, anticorps glod4, anticorps glod4.L, anticorps GLOD4, anticorps Glod4
- Sujet
- The function of GLOD4 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 33 kDa (MW of target protein)
-