GLOD4 anticorps (Middle Region)

N° du produit ABIN632471

Détail du produit anti-GLOD4 anticorps

Antigène: GLOD4 (Glyoxalase Domain Containing 4 (GLOD4))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GLOD4 est non-conjugé

Application: Western Blotting (WB)

Specificité: GLOD4 antibody was raised against the middle region of GLOD4

Purification: Affinity purified

Immunogène: GLOD4 antibody was raised using the middle region of GLOD4 corresponding to a region with amino acids LAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GLOD4 Blocking Peptide, catalog no. 33R-4809, is also available for use as a blocking control in assays to test for specificity of this GLOD4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLOD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GLOD4

Antigène: GLOD4 (Glyoxalase Domain Containing 4 (GLOD4))

Autre désignation: GLOD4 (GLOD4 Produits)

Synonymes: anticorps MGC76089, anticorps MGC84515, anticorps wu:fj45g03, anticorps zgc:103490, anticorps C17orf25, anticorps HC71, anticorps 1700082G03Rik, anticorps 2700085E05Rik, anticorps C81254, anticorps RGD1307010, anticorps glyoxalase domain containing 4, anticorps glyoxalase domain containing 4 L homeolog, anticorps glod4, anticorps glod4.L, anticorps GLOD4, anticorps Glod4

Sujet: The function of GLOD4 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 33 kDa (MW of target protein)