CAMK1D anticorps (Middle Region)

N° du produit ABIN632564

Détail du produit anti-CAMK1D anticorps

Antigène: CAMK1D (Calcium/calmodulin-Dependent Protein Kinase ID (CAMK1D))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CAMK1D est non-conjugé

Application: Western Blotting (WB)

Specificité: CAMK1 D antibody was raised against the middle region of CAMK1

Purification: Affinity purified

Immunogène: CAMK1 D antibody was raised using the middle region of CAMK1 corresponding to a region with amino acids KNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CAMK1D Blocking Peptide, catalog no. 33R-4567, is also available for use as a blocking control in assays to test for specificity of this CAMK1D antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAMK0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CAMK1D

Antigène: CAMK1D (Calcium/calmodulin-Dependent Protein Kinase ID (CAMK1D))

Autre désignation: CAMK1D (CAMK1D Produits)

Synonymes: anticorps CKLiK, anticorps CaM-K1, anticorps CaMKID, anticorps A630059D12Rik, anticorps CaMKIdelta, anticorps E030025C11Rik, anticorps CAMK1D, anticorps camk1d, anticorps zgc:158713, anticorps RGD1560691, anticorps zgc:172284, anticorps cam-ki, anticorps camk1d.L, anticorps calcium/calmodulin dependent protein kinase ID, anticorps calcium/calmodulin-dependent protein kinase ID, anticorps calcium/calmodulin-dependent protein kinase 1Db, anticorps calcium/calmodulin-dependent protein kinase 1Da, anticorps calcium/calmodulin dependent protein kinase ID S homeolog, anticorps CAMK1D, anticorps Camk1d, anticorps camk1db, anticorps LOAG_08089, anticorps camk1da, anticorps camk1d.S

Sujet: This gene encodes a member of the Ca2+/calmodulin-dependent protein kinase 1 subfamily of serine/threonine kinases. The encoded protein may be involved in the regulation of granulocyte function through the chemokine signal transduction pathway. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.

Poids moléculaire: 42 kDa (MW of target protein)