SDCCAG8 anticorps (N-Term)
-
- Antigène Voir toutes SDCCAG8 Anticorps
- SDCCAG8 (serologically Defined Colon Cancer Antigen 8 (SDCCAG8))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SDCCAG8 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SDCCAG8 antibody was raised against the N terminal of SDCCAG8
- Purification
- Affinity purified
- Immunogène
- SDCCAG8 antibody was raised using the N terminal of SDCCAG8 corresponding to a region with amino acids HEETNMPTMHDLVHTINDQSQYIHHLEAEVKFCKEELSGMKNKIQVVVLE
- Top Product
- Discover our top product SDCCAG8 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SDCCAG8 Blocking Peptide, catalog no. 33R-3716, is also available for use as a blocking control in assays to test for specificity of this SDCCAG8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDCCAG8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SDCCAG8 (serologically Defined Colon Cancer Antigen 8 (SDCCAG8))
- Autre désignation
- SDCCAG8 (SDCCAG8 Produits)
- Synonymes
- anticorps si:dkey-60b15.1, anticorps BBS16, anticorps CCCAP, anticorps CCCAP SLSN7, anticorps NPHP10, anticorps NY-CO-8, anticorps SLSN7, anticorps hCCCAP, anticorps 2700048G21Rik, anticorps 5730470G24Rik, anticorps Cccap, anticorps serologically defined colon cancer antigen 8, anticorps sdccag8, anticorps SDCCAG8, anticorps Sdccag8
- Sujet
- SDCCAG8 encodes a centrosome associated protein. This protein may be involved in organizing the centrosome during interphase and mitosis. Mutations in this gene are associated with retinal-renal ciliopathy.
- Poids moléculaire
- 83 kDa (MW of target protein)
- Pathways
- M Phase, Tube Formation
-