BRISC and BRCA1 A Complex Member 1 (BABAM1) (N-Term) anticorps

N° du produit ABIN632802

Détail du produit

Antigène: BRISC and BRCA1 A Complex Member 1 (BABAM1)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: C19 ORF62 antibody was raised against the N terminal Of C19 rf62

Purification: Affinity purified

Immunogène: C19 ORF62 antibody was raised using the N terminal Of C19 rf62 corresponding to a region with amino acids DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C19ORF62 Blocking Peptide, catalog no. 33R-2140, is also available for use as a blocking control in assays to test for specificity of this C19ORF62 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF62 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: BRISC and BRCA1 A Complex Member 1 (BABAM1)

Autre désignation: C19ORF62 (BABAM1 Produits)

Synonymes: anticorps merit40, anticorps nba1, anticorps zgc:100909, anticorps c19orf62, anticorps C19orf62, anticorps MERIT40, anticorps NBA1, anticorps C7H19orf62, anticorps 5430437P03Rik, anticorps Merit40, anticorps BRISC and BRCA1 A complex member 1, anticorps BRISC and BRCA1 A complex member 1 L homeolog, anticorps babam1, anticorps BABAM1, anticorps babam1.L, anticorps Babam1

Sujet: C19orf62 is a component of the BRCA1-A complex, a complex that specifically recognises 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs).

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Positive Regulation of Response to DNA Damage Stimulus