BRISC and BRCA1 A Complex Member 1 (BABAM1) (N-Term) anticorps

N° du produit ABIN632802

Cet anticorps anti-BRISC and BRCA1 A Complex Member 1 Polyclonal Lapin (ABIN632802) détecte spécifiquement BRISC and BRCA1 A Complex Member 1 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour BRISC and BRCA1 A Complex Member 1 (BABAM1) (N-Term) anticorps (ABIN632802)

Antigène: BRISC and BRCA1 A Complex Member 1 (BABAM1)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Détail du produit

Épitope: N-Term

Specificité: C19 ORF62 antibody was raised against the N terminal Of C19 rf62

Purification: Affinity purified

Immunogène: C19 ORF62 antibody was raised using the N terminal Of C19 rf62 corresponding to a region with amino acids DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C19ORF62 Blocking Peptide, (ABIN937526), is also available for use as a blocking control in assays to test for specificity of this C19ORF62 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF62 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: BRISC and BRCA1 A Complex Member 1 (BABAM1)

Autre désignation: C19ORF62

Sujet: C19orf62 is a component of the BRCA1-A complex, a complex that specifically recognises 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs).

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Positive Regulation of Response to DNA Damage Stimulus