PSMA4 anticorps
-
- Antigène Voir toutes PSMA4 Anticorps
- PSMA4 (Proteasome Subunit alpha 4 (PSMA4))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PSMA4 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PSMA4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGN
- Top Product
- Discover our top product PSMA4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PSMA4 Blocking Peptide, catalog no. 33R-6994, is also available for use as a blocking control in assays to test for specificity of this PSMA4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PSMA4 (Proteasome Subunit alpha 4 (PSMA4))
- Autre désignation
- PSMA4 (PSMA4 Produits)
- Synonymes
- anticorps wu:fe05d10, anticorps zgc:56176, anticorps DDBDRAFT_0204055, anticorps DDBDRAFT_0214953, anticorps DDB_0204055, anticorps DDB_0214953, anticorps C9, anticorps HC9, anticorps HsT17706, anticorps PSC9, anticorps proteasome subunit alpha 4, anticorps proteasome subunit alpha 4 S homeolog, anticorps proteasome subunit alpha type 4, anticorps 20S proteasome subunit alpha-4, anticorps proteasome (prosome, macropain) subunit, alpha type 4, anticorps psma4, anticorps psma4.S, anticorps PSMA4, anticorps CNF01860, anticorps psmA4, anticorps Psma4
- Sujet
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure.
- Poids moléculaire
- 21 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-