PSMA4 anticorps

N° du produit ABIN632890

Détail du produit anti-PSMA4 anticorps

Antigène: PSMA4 (Proteasome Subunit alpha 4 (PSMA4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSMA4 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PSMA4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSMA4 Blocking Peptide, catalog no. 33R-6994, is also available for use as a blocking control in assays to test for specificity of this PSMA4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSMA4

Antigène: PSMA4 (Proteasome Subunit alpha 4 (PSMA4))

Autre désignation: PSMA4 (PSMA4 Produits)

Synonymes: anticorps wu:fe05d10, anticorps zgc:56176, anticorps DDBDRAFT_0204055, anticorps DDBDRAFT_0214953, anticorps DDB_0204055, anticorps DDB_0214953, anticorps C9, anticorps HC9, anticorps HsT17706, anticorps PSC9, anticorps proteasome subunit alpha 4, anticorps proteasome subunit alpha 4 S homeolog, anticorps proteasome subunit alpha type 4, anticorps 20S proteasome subunit alpha-4, anticorps proteasome (prosome, macropain) subunit, alpha type 4, anticorps psma4, anticorps psma4.S, anticorps PSMA4, anticorps CNF01860, anticorps psmA4, anticorps Psma4

Sujet: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure.

Poids moléculaire: 21 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA